Haptoglobin Protein, Mouse (His)
Based on 1 Customer Validation
Haptoglobin Protein, Mouse (His) is the recombinant mouse-derived Haptoglobin, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Haptoglobin Protein, Mouse (His) is the recombinant mouse-derived Haptoglobin, expressed by E. coli , with N-6*His labeled tag.
Background
The Haptoglobin protein functions to capture and bind free plasma hemoglobin, preventing kidney damage and enabling hepatic recycling of heme iron. During hemolysis, hemoglobin can accumulate in the kidneys and be secreted in urine. Additionally, Haptoglobin acts as an antioxidant, exhibits antibacterial activity, and plays a role in modulating various aspects of the acute phase response. The complexes formed between hemoglobin and Haptoglobin are efficiently cleared by the macrophage CD163 scavenger receptor on liver Kupfer cells through an endocytic lysosomal degradation pathway. Notably, the uncleaved form of the alpha-2 allele (2-2), known as zonulin, has implications in intestinal permeability by regulating intercellular tight junction disassembly and influencing the balance between tolerance and immunity to non-self antigens.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
Q61646 (V19-N347)
-
Gene ID15439
-
Protein Length
Full Length of Mature Protein
-
Synonyms
HP; Haptoglobin Alpha(2FS)-Beta; Haptoglobin; Haptoglobin Alpha(1S)-Beta; Zonulin; HP Protein; Haptoglobin, Alpha Polypeptide; HP2ALPHA2; Haptoglobin, Beta Polypeptide; HPA1S; Liver regeneration-related protein LRRG173
-
AA Sequence
VELGNDAMDFEDDSCPKPPEIANGYVEHLVRYRCRQFYRLRAEGDGVYTLNDEKQWVNTVAGEKLPECEAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQWLLTTAKNLFLNHSETASAKDITPTLTLYVGKNQLVEIEKVVLHPNHSVVDIGLIKLKQRVLVTERVMPICLPSKDYIAPGRVGYVSGWGRNANFRFTDRLKYVMLPVADQDKCVVHYENSTVPEKKNLTSPVGVQPILNEHTFCAGLTKYQEDTCYGDAGSAFAIHDMEEDTWYAAGILSFDKSCAVAEYGVYVRATDLKDWVQETMAKN
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 2 mM DTT, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)