1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC chemokine subfamily
  5. HCC-1/CCL14 Protein, Human

HCC-1/CCL14 Protein, Human

Cat. No.: HY-P7195
Handling Instructions

HCC-1/CCL14 Protein, Human has weak activities on human monocytes and acts via receptors that also recognize MIP-1 alpha.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $190 In-stock
Estimated Time of Arrival: December 31
50 μg $420 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

HCC-1/CCL14 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q16627 (T22-N93)

Gene ID

6358

Synonyms
rHuHCC-1/CCL14; C-C motif chemokine 14; SCYA14
AA Sequence

TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Molecular Weight

Approximately 8.4 kDa

Biological Activity
The ED50 is <25 μg/mL as measured by CHO cells transfected with human CCR5, corresponding to a specific activity of >40 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Human Hemofiltrate CC Chemokine-1/CCL14 (HCC-1) is expressed constitutively in several normal tissues (spleen, liver, skeletal and heart muscle, gut, and bone marrow), and is present at high concentrations (1-80 nM) in plasma. HCC-1 has weak activities on human monocytes and acts via receptors that also recognize MIP-lot. It induces intracellular Ca2+ changes and enzyme release, but no chemotaxis, at concentrations of 100-1,000 nM, and is inactive on T lymphocytes, neutrophils, and eosinophil leukocytes. In addition, HCC-1 enhances the proliferation of CD34+ myeloid progenitor cells. It is as effective as MIP-1α, but about 100-fold less potent[1]. CCL14 regulate extracellular matrix and adhesion molecules in the trophoblast[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HCC-1/CCL14 Protein, Human
Cat. No.:
HY-P7195
Quantity:
MCE Japan Authorized Agent: