HCC-1/CCL14 Protein, Human

Customer Review

Based on 1 Customer Validation

HCC-1/CCL14 Protein, Human is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein, Human is a recombinant human HCC-1/CCL14(T22-N93) expressed by E. coli.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

HCC-1/CCL14 Protein, Human is a CC chemokine with weak activity against human monocytes, promotes monocyte, eosinophil and T-lymphocyte chemotaxis, and mediates allergic airway inflammation and cancer. HCC-1/CCL14 Protein, Human is a recombinant human HCC-1/CCL14(T22-N93) expressed by E. coli[1][2].

Background

CCL14, also known as HCC-1, is a human plasma chemokine originally collected and purified from the hemofiltrate of patients with chronic renal failure. CCL14 belongs to the small cytokine family of CC chemokines, a cluster of chemokines located on human chromosome 17 that can be expressed in a variety of tissues, including spleen, bone marrow, liver, muscle, and intestine. CCL14 has weak activity against human monocytes and no activity against T lymphocytes, neutrophils, and eosinophils. CCL14 is weakly active against human monocytes and inactive against T lymphocytes, neutrophils, and eosinophils.CCL14 acts as a protein precursor that requires protein hydrolysis to obtain receptor affinity and is processed to yield a mature active protein containing 74 amino acids. The processed HCC-1(9-74) is a chemokine that attracts monocytes, eosinophils and T cells and binds to CCR1, CCR3 and CCR5 chemokine receptors[2]. Post-translational modifications of CCL14 chemokines, such as N-terminal truncation and glycosylation, also result in differential signaling compared to unmodified ones. For example, both full-length CCL14(1-74) and truncated isoform CCL14(9-74) bind to atypical chemokine receptor 2 (ACKR2), but only truncated CCL14(9-74) shows a propensity for β-restin and induces receptor internalization of ACKR2 compared to CCL14(1-74). Meanwhile, CCL14(1-74) was a weak agonist of chemokine receptor CCR1, but its activity was significantly enhanced after proteolytic cleavage to CCL14(9-74)[1]. CCL14 has been shown to inhibit HCC cell proliferation by inhibiting cell cycle progression and promoting apoptosis in hepatocellular carcinoma (HCC) cells.CCL14 inhibits HCC tumor growth in nude mice in vivo.CCL14 is also involved in the pathogenesis and progression of various diseases, including allergic airway inflammation and some cancers[2].

In Vitro

CCL14 (10 nM, 22 h) can increase trophoblast adhesion to fibronectin by 3-fold and increase expression of extracellular matrix and adhesion molecules such as collagen COL5A1, matrix metalloproteinase MMP12 in human choriocarcinoma-primary trophoblast hybrid AC1M-88 cell line[3].

Verified Bioactivity

1.Fully biologically active when compared to standard. The biological activity deter mined by a chemotaxis bloassay using human monocytes is in a concentration of 5.0-20 ng/mL.
2.Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 this effect is 4.297 ng/mL, corresponding to a specific activity is 2.33×105 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 4.297 ng/mL, corresponding to a specific activity is 2.33×105 U/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL14 (T22-N93)
      Accession # Q16627-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    CCL14; C-C Motif Chemokine 14; Prev. SCYA14; HCC-1(1-74); NCC-2; HCC-1/HCC-3; HCC-1; NCC2; HCC-3; Hemofiltrate CC Chemokine 1; SCYL2; C-C Motif Chemokine; CKb1; New CC Chemokine 2; MCIF; Chemokine CC-3; Small Inducible Cytokine Subfamily A (Cys-Cys), Memb

  • AA Sequence

    TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

  • Predicted Molecular Mass

    8.5 kDa

  • Molecular Weight

    Approximately 8-10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00