HE4/WFDC2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
HE4/WFDC2 protein is a disulfide-bonded homotrimer serving as a broad range protease inhibitor. HE4/WFDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HE4/WFDC2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
HE4/WFDC2 protein is a disulfide-bonded homotrimer serving as a broad range protease inhibitor. HE4/WFDC2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived HE4/WFDC2 protein, expressed by HEK293 , with C-His labeled tag.
Background
HE4/WFDC2 protein is a broad range protease inhibitor that functions as a homotrimer, connected by disulfide bonds.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q9DAU7 (T26-F174)
-
Molecular Construction
-
N-term
-
HE4 (T26-F174)
Accession # Q9DAU7 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
WFDC2; WAP Four-Disulfide Core Domain 2; WAP5; HE4; WAP Four-Disulfide Core Domain Protein 2; DJ461P17.6; EDDM4; Major Epididymis-Specific Protein E4; Putative Protease Inhibitor WAP5; Epididymal Secretory Protein E4; Human Epididymis Protein 4; Epididyma
-
AA Sequence
TGTDAEKPGECPQLEPITDCVLECTLDKDCADNRKCCQAGCSSVCSKPNGPSEGELSGTDTKLSETGTTTQSAGLDHTTKPPGGQVSTKPPAVTREGLGVREKQGTCPSVDIPKLGLCEDQCQVDSQCSGNMKCCRNGCGKMACTTPKF
-
Predicted Molecular Mass
15.5 kDa
-
Molecular Weight
Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (233 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
