HEMK2 Protein, Human (His)
Based on 1 Customer Validation
Contrary to the expected interaction, HEMK2 protein did not bind to TRMT112. This unique feature distinguishes HEMK2 from expected protein-protein interactions typically associated with its functional counterparts. HEMK2 Protein, Human (His) is the recombinant human-derived HEMK2 protein, expressed by E. coli , with C-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Contrary to the expected interaction, HEMK2 protein did not bind to TRMT112. This unique feature distinguishes HEMK2 from expected protein-protein interactions typically associated with its functional counterparts. HEMK2 Protein, Human (His) is the recombinant human-derived HEMK2 protein, expressed by E. coli , with C-His labeled tag.
HEMK2 protein, based on available information, does not interact with TRMT112. TRMT112 is a protein known to form complexes with certain methyltransferases and influence their enzymatic activities. The absence of interaction between HEMK2 and TRMT112 suggests a unique molecular profile for HEMK2, distinct from other methyltransferases that may engage with TRMT112 for functional modulation. Understanding the specific protein-protein interactions and regulatory associations of HEMK2 is crucial for unraveling its role in cellular processes and potential contributions to biological pathways. Further research is needed to elucidate the precise functions and implications associated with HEMK2, particularly in the context of its distinct interaction patterns. (
Measured by its binding ability in a functional ELISA. When Recombinant Human HEMK2 is present at 10 μg/mL, can bind N6AMT1 Polyclonal antibody. The ED50 for this effect is 5.677 ng/mL.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-His
-
Accession
Q9Y5N5-2 (M1-S186)
-
Molecular Construction
-
N-term
-
HEMK2 (M1-S186)
Accession # Q9Y5N5-2 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
HEMK2; N-6 Adenine-Specific DNA Methyltransferase 1 (Putative); Prev. C21orf127; Methylarsonite Methyltransferase N6AMT1; Prev. N6AMT1; Lysine N-Methyltransferase 9; PRED28; Methyltransferase N6AMT1; KMT9; Methyltransferase HEMK2; HemK Methyltransferase F
-
AA Sequence
MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
