HEMK2 Protein, Human (His)

Contrary to the expected interaction, HEMK2 protein did not bind to TRMT112. This unique feature distinguishes HEMK2 from expected protein-protein interactions typically associated with its functional counterparts. HEMK2 Protein, Human (His) is the recombinant human-derived HEMK2 protein, expressed by E. coli , with C-His labeled tag. The total length of HEMK2 Protein, Human (His) is 186 a.a., with molecular weight of ~23 kDa.

HEMK2 protein, based on available information, does not interact with TRMT112. TRMT112 is a protein known to form complexes with certain methyltransferases and influence their enzymatic activities. The absence of interaction between HEMK2 and TRMT112 suggests a unique molecular profile for HEMK2, distinct from other methyltransferases that may engage with TRMT112 for functional modulation. Understanding the specific protein-protein interactions and regulatory associations of HEMK2 is crucial for unraveling its role in cellular processes and potential contributions to biological pathways. Further research is needed to elucidate the precise functions and implications associated with HEMK2, particularly in the context of its distinct interaction patterns. (

Measured by its binding ability in a functional ELISA. When Recombinant Human HEMK2 is present at 10 μg/mL, can bind N6AMT1 Polyclonal antibody. The ED₅₀ for this effect is 5.677 ng/mL.

Human

E. coli

C-His

Q9Y5N5-2 (M1-S186)

29104  [NCBI]

MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS

Approximately 23 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.