Hemopexin Protein, Rat (His)
Hemopexin Protein, with its heme-binding ability, acts as a transporter, facilitating heme transport to the liver. In the liver, heme is broken down, and the recovered iron is utilized. The liberated hemopexin protein then returns to circulation, underscoring its vital role in efficiently managing heme and iron metabolism in the body. Hemopexin Protein, Rat (His) is the recombinant rat-derived Hemopexin protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Hemopexin Protein, with its heme-binding ability, acts as a transporter, facilitating heme transport to the liver. In the liver, heme is broken down, and the recovered iron is utilized. The liberated hemopexin protein then returns to circulation, underscoring its vital role in efficiently managing heme and iron metabolism in the body. Hemopexin Protein, Rat (His) is the recombinant rat-derived Hemopexin protein, expressed by E. coli , with N-6*His labeled tag.
The Hemopexin protein exhibits the ability to bind to heme, serving as a transporter to facilitate its transportation to the liver. Once in the liver, heme is broken down, and the iron is recovered. Subsequently, the hemopexin protein, now free from heme, returns to circulation. This mechanism highlights the crucial role of hemopexin in the efficient management of heme and iron metabolism within the body.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-6*His
-
Accession
P20059 (N24-Q460)
-
Molecular Construction
-
N-term
-
6*His
-
Hemopexin (N24-Q460)
Accession # P20059 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
HPX; Epididymis Secretory Sperm Binding Protein; Hemopexin; HX; Beta-1B-Glycoprotein
-
AA Sequence
NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ
-
Predicted Molecular Mass
52.9 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
