Histone H3.3 Protein, Human

Customer Review

Based on 1 Customer Validation

Histone H3.3 Protein, Human is the recombinant human-derived Histone H3.3 protein, expressed by E. coli, with tag free tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Histone H3.3 Protein, Human is the recombinant human-derived Histone H3.3 protein, expressed by E. coli, with tag free tag.

Background

Histone H3, a fundamental component of the nucleosome, serves as a linchpin in the intricate process of wrapping and compacting DNA into chromatin, which in turn restricts DNA accessibility to cellular machineries requiring DNA as a template. This histone, alongside its counterparts, assumes a pivotal role in pivotal cellular functions, including transcription regulation, DNA repair, DNA replication, and the maintenance of chromosomal stability. The regulation of DNA accessibility involves a sophisticated interplay of post-translational modifications collectively referred to as the histone code, coupled with the dynamic remodeling of nucleosomes. The nucleosome itself comprises a histone octamer, composed of two molecules each of H2A, H2B, H3, and H4, assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. This octamer efficiently wraps approximately 147 base pairs of DNA, exemplifying its indispensable role in organizing chromatin structure and facilitating crucial genomic processes. Additionally, Histone H3 interacts with various cellular components such as TONSL, CHAF1A, CHAF1B, MCM2, and DNAJC9, further contributing to its multifaceted functions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    H3-3A; H3 Histone, Family 3A; Prev. H3F3A; Histone H3; Prev. H3F3; BRYLIB1; H3.3A; H3F3B; H3 Histone Family Member 3A; H3.3B; H3.3 Histone A; Histone H3.3

  • AA Sequence

    MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

  • Predicted Molecular Mass

    15.3 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 10 mM Tris-HCl (pH 7.5), 50 mM NaCl, 2 mM β-ME, 2 mM EDTA.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00