HLA-DMA Protein, Human (His)

HLA-DMA proteins are key members of the MHC class II family and are essential for antigen presentation and immune response regulation. In this family, HLA-DMA is actively involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. HLA-DMA Protein, Human (His) is the recombinant human-derived HLA-DMA protein, expressed by E. coli , with N-His labeled tag.

The HLA-DMA Protein is an essential member of the MHC class II family, playing a crucial role in antigen presentation and immune response regulation. As part of this family, HLA-DMA is involved in the loading and exchange of peptides within the MHC class II antigen-binding groove. Recognized for its significance in the immune system, the HLA-DMA protein contributes to the activation of CD4+ T helper cells by presenting antigens derived from extracellular pathogens. Through its association with the MHC class II family, HLA-DMA underscores its integral role in facilitating adaptive immune responses and enhancing our understanding of immune system dynamics in health and disease.

Human

E. coli

N-His

Q6ICR9 (V27-C233)

3108  [NCBI]

Partial

VPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLSEAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKIPVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLC

Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, 6% Trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.