HLA-G Protein, Human (His-SUMO)
HLA-G is a nonclassical major histocompatibility class Ib molecule that is critical for immune regulation at the maternal-fetal interface. It cooperates with B2M to form a complex that selectively binds self-peptides to promote maternal-fetal tolerance by interacting with KIR2DL4, LILRB1, and LILRB2 receptors. HLA-G Protein, Human (His-SUMO) is the recombinant human-derived HLA-G protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
HLA-G is a nonclassical major histocompatibility class Ib molecule that is critical for immune regulation at the maternal-fetal interface. It cooperates with B2M to form a complex that selectively binds self-peptides to promote maternal-fetal tolerance by interacting with KIR2DL4, LILRB1, and LILRB2 receptors. HLA-G Protein, Human (His-SUMO) is the recombinant human-derived HLA-G protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
HLA-G, a non-classical major histocompatibility class Ib molecule, plays a crucial role in immune regulation at the maternal-fetal interface. In association with B2M/beta-2 microglobulin, it forms a complex that selectively binds a limited repertoire of nonamer self-peptides derived from intracellular proteins, including histones and ribosomal proteins. This peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1, and LILRB2 receptors on uterine immune cells, fostering fetal development while maintaining maternal-fetal tolerance. Interactions with KIR2DL4 and LILRB1 receptors trigger NK cell senescence-associated secretory phenotype, promoting vascular remodeling and fetal growth during early pregnancy. Moreover, HLA-G's engagement with LILRB2 induces the differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, actively contributing to the maintenance of maternal-fetal tolerance. Additionally, HLA-G may play a role in balancing tolerance and antiviral immunity by modulating the effector functions of NK cells, CD8+ T cells, and B cells. Furthermore, it negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity, highlighting its multifaceted role in immune regulation at the maternal-fetal interface.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
P17693-1 (G25-D338)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
HLA-G (G25-D338)
Accession # P17693-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
HLAG; HLA-6.0; HLA-G; sHLA-G; Soluble HLA class I histocompatibility antigen, alpha chain G; MHC class I antigen G; HLA G antigen; HLA class I histocompatibility antigen, alpha chain G
-
AA Sequence
GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
-
Predicted Molecular Mass
51.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)