HNRNPA2B1 Protein, Mouse (His-SUMO, Myc)
Based on 1 Customer Validation
The HNRNPA2B1 protein is an important heterogeneous nuclear ribonucleoprotein (hnRNP) that plays a key role in RNA processing and transport. It forms hnRNP particles that compact and stabilize transcripts to influence various cellular functions, including transcription, mRNA processing, nuclear export, localization, translation, and mRNA stability. HNRNPA2B1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived HNRNPA2B1 protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The HNRNPA2B1 protein is an important heterogeneous nuclear ribonucleoprotein (hnRNP) that plays a key role in RNA processing and transport. It forms hnRNP particles that compact and stabilize transcripts to influence various cellular functions, including transcription, mRNA processing, nuclear export, localization, translation, and mRNA stability. HNRNPA2B1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived HNRNPA2B1 protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.
Background
HNRNPA2B1 Protein, a heterogeneous nuclear ribonucleoprotein (hnRNP), plays a pivotal role in RNA processing and transport. It associates with nascent pre-mRNAs, participating in the formation of hnRNP particles that condense and stabilize transcripts, minimizing tangling and knotting. This packaging process influences various cellular functions, including transcription, pre-mRNA processing, RNA nuclear export, subcellular localization, mRNA translation, and the stability of mature mRNAs. HNRNPA2B1 forms hnRNP particles with multiple hnRNPs and heterogeneous nuclear RNAs in the nucleus. Notably, in oligodendrocytes and neurons, it facilitates the transport of specific mRNAs to the cytoplasm by recognizing and binding A2RE or A2RE11 sequence motifs on select mRNAs. Beyond mRNA transport, HNRNPA2B1 also binds telomeric DNA sequences, protecting them from endonuclease digestion, and acts as a 'reader' of the N6-methyladenosine (m6A) mark on pri-miRNAs, promoting pri-miRNA processing and miRNA sorting into exosomes. Additionally, it serves as a regulator of mRNA splicing, impacting the splicing of genes like pyruvate kinase PKM. Furthermore, HNRNPA2B1 is implicated in the activation of the innate immune response, sensing viral DNA, and translocating to the cytoplasm to activate the TBK1-IRF3 pathway. These diverse functions highlight the versatility of HNRNPA2B1 in cellular processes.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His;N-SUMO;C-Myc
-
Accession
O88569 (M1-Y353)
-
Molecular Construction
-
N-term
-
10*His-SUMO
-
HNRNPA2B1 (M1-Y353)
Accession # O88569 -
Myc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
HNRNPA2B1; HnRNP A2 / HnRNP B1; Prev. HNRPA2B1; IBMPFD2; Heterogeneous Nuclear Ribonucleoproteins A2/B1; HNRPA2; HNRNPA2; HNRPB1; HNRNPB1; SNRPB1; Nuclear Ribonucleoprotein Particle A2 Protein; OPDM2; Epididymis Secretory Sperm Binding Protein; OPMD2; HNR
-
AA Sequence
MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY
-
Predicted Molecular Mass
57.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)