HNRNPA2B1 Protein, Mouse (His-SUMO, Myc)

Customer Review

Based on 1 Customer Validation

The HNRNPA2B1 protein is an important heterogeneous nuclear ribonucleoprotein (hnRNP) that plays a key role in RNA processing and transport. It forms hnRNP particles that compact and stabilize transcripts to influence various cellular functions, including transcription, mRNA processing, nuclear export, localization, translation, and mRNA stability. HNRNPA2B1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived HNRNPA2B1 protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The HNRNPA2B1 protein is an important heterogeneous nuclear ribonucleoprotein (hnRNP) that plays a key role in RNA processing and transport. It forms hnRNP particles that compact and stabilize transcripts to influence various cellular functions, including transcription, mRNA processing, nuclear export, localization, translation, and mRNA stability. HNRNPA2B1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived HNRNPA2B1 protein, expressed by E. coli , with N-10*His, N-SUMO, C-Myc labeled tag.

Background

HNRNPA2B1 Protein, a heterogeneous nuclear ribonucleoprotein (hnRNP), plays a pivotal role in RNA processing and transport. It associates with nascent pre-mRNAs, participating in the formation of hnRNP particles that condense and stabilize transcripts, minimizing tangling and knotting. This packaging process influences various cellular functions, including transcription, pre-mRNA processing, RNA nuclear export, subcellular localization, mRNA translation, and the stability of mature mRNAs. HNRNPA2B1 forms hnRNP particles with multiple hnRNPs and heterogeneous nuclear RNAs in the nucleus. Notably, in oligodendrocytes and neurons, it facilitates the transport of specific mRNAs to the cytoplasm by recognizing and binding A2RE or A2RE11 sequence motifs on select mRNAs. Beyond mRNA transport, HNRNPA2B1 also binds telomeric DNA sequences, protecting them from endonuclease digestion, and acts as a 'reader' of the N6-methyladenosine (m6A) mark on pri-miRNAs, promoting pri-miRNA processing and miRNA sorting into exosomes. Additionally, it serves as a regulator of mRNA splicing, impacting the splicing of genes like pyruvate kinase PKM. Furthermore, HNRNPA2B1 is implicated in the activation of the innate immune response, sensing viral DNA, and translocating to the cytoplasm to activate the TBK1-IRF3 pathway. These diverse functions highlight the versatility of HNRNPA2B1 in cellular processes.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-10*His;N-SUMO;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His-SUMO
    • HNRNPA2B1 (M1-Y353)
      Accession # O88569
    • Myc
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    HNRNPA2B1; HnRNP A2 / HnRNP B1; Prev. HNRPA2B1; IBMPFD2; Heterogeneous Nuclear Ribonucleoproteins A2/B1; HNRPA2; HNRNPA2; HNRPB1; HNRNPB1; SNRPB1; Nuclear Ribonucleoprotein Particle A2 Protein; OPDM2; Epididymis Secretory Sperm Binding Protein; OPMD2; HNR

  • AA Sequence

    MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

  • Predicted Molecular Mass

    57.4 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00