glycoprotein D/gD Protein, HSV-2 (HEK293, His)
Based on 1 Customer Validation
glycoprotein D/gD Protein, HSV-2 (HEK293, His) is the recombinant virus-derived glycoprotein D/gD protein, expressed by HEK293, with C-His tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
glycoprotein D/gD Protein, HSV-2 (HEK293, His) is the recombinant virus-derived glycoprotein D/gD protein, expressed by HEK293, with C-His tag.
Background
Envelope glycoprotein D (gD) plays a pivotal role in the viral life cycle by binding to potential host cell entry receptors, including TNFRSF14/HVEM and NECTIN1. Its interaction with these receptors may initiate fusion with the host membrane, a crucial step facilitated by the recruitment of the fusion machinery composed of gB and gH/gL. Existing as a homodimer, gD engages in various interactions with host receptors, such as TNFRSF14 and NECTINs, contributing to the intricate process of viral entry. Notably, gD forms associations with both gB and the gH/gL heterodimer, essential components of the fusion complex, highlighting its multifaceted role in the viral entry process. Additionally, gD interacts with the UL11 tegument protein, further emphasizing its involvement in the intricate interplay of viral proteins during infection.
Verified Bioactivity
1.Immobilized Recombinant Human CD111 / Nectin-1 / PVRL1 Protein (Fc Tag) at 2 μg/ml (100 μl/well) can bind Recombinant HSV 2 (strain 333) gD Protein (ECD, His Tag), the EC50 is 30-100 ng/mL.
2.Immobilized HSV 2 (strain 333) gD Protein (ECD, His Tag)(MALS-verified) at 5 μg/mL (100 μL/well) can bind Recombinant Human Nectin-1/PVRL1 Protein (hFc Tag), the EC50 is 1.5 ng/mL.
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-His
-
Accession
P03172 (K26-T310)
-
Gene ID/
-
Protein Length
Partial
-
Synonyms
PAEP; PP14 Protein (Placental Protein 14); Progestagen Associated Endometrial Protein; Zona-Binding Inhibitory Factor-1; Glycodelin; Alpha Uterine Protein; PP14; Placental Protein 14; PAEG; Glycodelin-A; GD; Glycodelin-S; Progesterone-Associated Endometri
-
AA Sequence
KYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGT
-
Predicted Molecular Mass
33.3 kDa
-
Molecular Weight
Approximately 40-47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)