glycoprotein D/gD Protein, HSV-2 (HEK293, His)

glycoprotein D/gD Protein, HSV-2 (HEK293, His) is the recombinant virus-derived glycoprotein D/gD protein, expressed by HEK293, with C-His tag.

Envelope glycoprotein D (gD) plays a pivotal role in the viral life cycle by binding to potential host cell entry receptors, including TNFRSF14/HVEM and NECTIN1. Its interaction with these receptors may initiate fusion with the host membrane, a crucial step facilitated by the recruitment of the fusion machinery composed of gB and gH/gL. Existing as a homodimer, gD engages in various interactions with host receptors, such as TNFRSF14 and NECTINs, contributing to the intricate process of viral entry. Notably, gD forms associations with both gB and the gH/gL heterodimer, essential components of the fusion complex, highlighting its multifaceted role in the viral entry process. Additionally, gD interacts with the UL11 tegument protein, further emphasizing its involvement in the intricate interplay of viral proteins during infection.

1.Immobilized Recombinant Human CD111 / Nectin-1 / PVRL1 Protein (Fc Tag) at 2 μg/ml (100 μl/well) can bind Recombinant HSV 2 (strain 333) gD Protein (ECD, His Tag), the EC₅₀ is 30-100 ng/mL.
2.Immobilized HSV 2 (strain 333) gD Protein (ECD, His Tag)(MALS-verified) at 5 μg/mL (100 μL/well) can bind Recombinant Human Nectin-1/PVRL1 Protein (hFc Tag), the EC₅₀ is 1.5 ng/mL.

Virus

HEK293

C-His

P03172 (K26-T310)

/

Partial

KYALADPSLKMADPNRFRGKNLPVLDRLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYAVLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPYNKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAGWHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGT

Approximately 42.79 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.