1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. ido Protein, Bacillus thuringiensis

IDO Protein, an enzyme, is involved in the conversion of tryptophan to kynurenine. Dysregulation of IDO Protein has been associated with immune suppression and tumor development. Targeting IDO Protein may present potential therapeutic approaches in cancer by modulating tryptophan metabolism, restoring immune responses, and inhibiting tumor growth. ido Protein, Bacillus thuringiensis is the recombinant ido protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IDO Protein, an enzyme, is involved in the conversion of tryptophan to kynurenine. Dysregulation of IDO Protein has been associated with immune suppression and tumor development. Targeting IDO Protein may present potential therapeutic approaches in cancer by modulating tryptophan metabolism, restoring immune responses, and inhibiting tumor growth. ido Protein, Bacillus thuringiensis is the recombinant ido protein, expressed by E. coli , with tag free.

Background

The ido protein emerges as a versatile catalyst, driving the hydroxylation of L-isoleucine to generate (4S)-4-hydroxy-L-isoleucine, a phenomenon documented across various studies. Beyond its role in L-isoleucine hydroxylation, ido showcases its enzymatic prowess by catalyzing the hydroxylation of L-leucine, L-norvaline, L-norleucine, and L-allo-isoleucine. Additionally, ido exhibits a broad substrate specificity, engaging in the sulfoxidation reactions of L-methionine, L-ethionine, S-methyl-L-cysteine, S-ethyl-L-cysteine, and S-allyl-L-cysteine. This enzymatic versatility positions the ido protein as a key player in diverse biochemical pathways, underscoring its impact on multiple metabolic processes.

Species

Others

Source

E. coli

Tag

Tag Free

Accession

E2GIN1 (M1-K240)

Gene ID

/

Molecular Construction
N-term
ido (M1-K240)
Accession # E2GIN1
C-term
Protein Length

Full Length

Synonyms
ido; L-isoleucine-4-hydroxylase; L-isoleucine dioxygenase; IDO
AA Sequence

MKMSGFSIEEKVHEFESKGFLEISNEIFLQEEENHSLLTQAQLDYYNLEDDAYGECRARSYSRYIKYVDSPDYILDNSNDYFQSKEYNYDDGGKVRQFNSINDSFLCNPLIQNIVRFDTEFAFKTNIIDKSKDLIIGLHQVRYKATKERPSFSSPIWLHKDDEPVVFLHLMNLSNTAIGGDNLIANSPREINQFISLKEPLETLVFGQKVFHAVTPLGTECSTEAFRDILLVTFSYKETK

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

ido Protein, Bacillus thuringiensis Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ido Protein, Bacillus thuringiensis

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ido Protein, Bacillus thuringiensis
Cat. No.:
HY-P702162
Quantity:
MCE Japan Authorized Agent: