ido Protein, Bacillus thuringiensis
IDO Protein, an enzyme, is involved in the conversion of tryptophan to kynurenine. Dysregulation of IDO Protein has been associated with immune suppression and tumor development. Targeting IDO Protein may present potential therapeutic approaches in cancer by modulating tryptophan metabolism, restoring immune responses, and inhibiting tumor growth. ido Protein, Bacillus thuringiensis is the recombinant ido protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
IDO Protein, an enzyme, is involved in the conversion of tryptophan to kynurenine. Dysregulation of IDO Protein has been associated with immune suppression and tumor development. Targeting IDO Protein may present potential therapeutic approaches in cancer by modulating tryptophan metabolism, restoring immune responses, and inhibiting tumor growth. ido Protein, Bacillus thuringiensis is the recombinant ido protein, expressed by E. coli , with tag free.
The ido protein emerges as a versatile catalyst, driving the hydroxylation of L-isoleucine to generate (4S)-4-hydroxy-L-isoleucine, a phenomenon documented across various studies. Beyond its role in L-isoleucine hydroxylation, ido showcases its enzymatic prowess by catalyzing the hydroxylation of L-leucine, L-norvaline, L-norleucine, and L-allo-isoleucine. Additionally, ido exhibits a broad substrate specificity, engaging in the sulfoxidation reactions of L-methionine, L-ethionine, S-methyl-L-cysteine, S-ethyl-L-cysteine, and S-allyl-L-cysteine. This enzymatic versatility positions the ido protein as a key player in diverse biochemical pathways, underscoring its impact on multiple metabolic processes.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
E2GIN1 (M1-K240)
-
Gene ID/
-
Molecular Construction
-
N-term
-
ido (M1-K240)
Accession # E2GIN1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
IDO1; Indoleamine-Pyrrole 2,3-Dioxygenase; Prev. INDO; Indolamine 2,3 Dioxygenase; Prev. IDO; Indole 2,3-Dioxygenase; IDO-1; Indoleamine 2,3-Dioxygenase 1; Indoleamine-Pyrrole 2,3 Dioxygenase
-
AA Sequence
MKMSGFSIEEKVHEFESKGFLEISNEIFLQEEENHSLLTQAQLDYYNLEDDAYGECRARSYSRYIKYVDSPDYILDNSNDYFQSKEYNYDDGGKVRQFNSINDSFLCNPLIQNIVRFDTEFAFKTNIIDKSKDLIIGLHQVRYKATKERPSFSSPIWLHKDDEPVVFLHLMNLSNTAIGGDNLIANSPREINQFISLKEPLETLVFGQKVFHAVTPLGTECSTEAFRDILLVTFSYKETK
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
