IFI35 Protein, Mouse (His)
The IFI35 protein is a signaling pathway regulator in the innate immune system and forms a complex with NMI in response to IFN-α. This complex prevents IFI35 degradation, causes IFI35 dephosphorylation, and inhibits virus-triggered interferon/IFN-β production. IFI35 Protein, Mouse (His) is the recombinant mouse-derived IFI35 protein, expressed by E. coli , with N-10*His labeled tag. The total length of IFI35 Protein, Mouse (His) is 286 a.a., with molecular weight of ~38 kDa.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
The IFI35 protein is a signaling pathway regulator in the innate immune system and forms a complex with NMI in response to IFN-α. This complex prevents IFI35 degradation, causes IFI35 dephosphorylation, and inhibits virus-triggered interferon/IFN-β production. IFI35 Protein, Mouse (His) is the recombinant mouse-derived IFI35 protein, expressed by E. coli , with N-10*His labeled tag. The total length of IFI35 Protein, Mouse (His) is 286 a.a., with molecular weight of ~38 kDa.
Background
IFI35 Protein acts as a signaling pathway regulator in the innate immune system response. In response to interferon IFN-alpha, it forms a complex with the transcriptional regulator NMI, preventing proteasome-mediated degradation of IFI35 and leading to IFI35 dephosphorylation. This complex also inhibits virus-triggered type I interferon/IFN-beta production and negatively regulates nuclear factor NF-kappa-B signaling. This inhibition results in the prevention of endothelial cell proliferation, migration, and re-endothelialization of injured arteries. Beyond its intracellular role, IFI35 functions extracellularly as damage-associated molecular patterns (DAMPs), promoting inflammation when released by macrophages during cell injury and pathogen invasion. Macrophage-secreted IFI35 activates NF-kappa-B signaling in adjacent macrophages through Toll-like receptor 4/TLR4 activation, inducing NF-kappa-B translocation and the release of pro-inflammatory cytokines. IFI35 homodimerizes and interacts with B-ATF, TRIM21, and directly with NMI in a complex facilitated by TRIM21.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His
-
Accession
Q9D8C4 (M1-S286)
-
Gene ID70110
-
Molecular Construction
-
N-term
-
10*His
-
IFI35 (M1-S286)
Accession # Q9D8C4 -
C-term
-
-
AA Sequence
MSVTLQTVLYSLQEEQARLKMRLQELQQLKRERTGSPGAKIPFSVPEVPLVFQGQTKQGRQVPKFVVSNLKVCCPLPEGSALVTFEDPKVVDRLLQQKEHRVNLEDCRLRVQVQPLELPVVTNIQVSSQPDNHRVLVSGFPAGLRLSEEELLDKLEIFFGKAKNGGGDVETREMLQGTVMLGFADEEVAQHLCQIGQFRVPLDRQQVLLRVSPYVSGEIQKAEIKFQQAPHSVLVTNIPDVMDAQELHDILEIHFQKPTRGGGEVEALTVVPSGQQGLAIFTSESS
-
Predicted Molecular Mass
37.9 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
