IFNT1 Protein, Sheep (P. pastoris, His)

Interferon tau-1 (IFNT1) serves as an important paracrine hormone that initiates maternal recognition of pregnancy. After interacting with endometrial receptors, possibly type I interferon receptors, IFNT1 blocks estrogen receptor expression and prevents estrogen-induced upregulation of oxytocin receptor expression. IFNT1 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived Interferon tau-1/IFNT1 protein, expressed by P. pastoris, with C-6*His labeled tag.

Interferon tau-1 (IFNT1) serves as a paracrine hormone pivotal for initiating maternal recognition of pregnancy. Upon interaction with endometrial receptors, likely type I interferon receptors, IFNT1 plays a crucial role in blocking estrogen receptor expression, effectively impeding the estrogen-induced upregulation of oxytocin receptor expression in the endometrium. This mechanism results in the suppression of pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, thereby preventing the regression of the corpus luteum (luteolysis) and facilitating the maintenance of ovarian cyclicity. Additionally, IFNT1, possibly through a direct impact on prostaglandin synthesis, sustains ovarian progesterone secretion, stimulating the endometrial secretion of nutrients necessary for conceptus growth. Notably, IFNT1 exhibits exceptional antiviral and antiproliferative potency, coupled with low cytotoxicity, high antiluteolytic activity, and immunomodulatory properties. A distinctive feature is its lack of virally inducibility in contrast to other interferons.

Sheep

P. pastoris

C-6*His

P56828 (C24-P195)

100144750

Full Length of Mature Protein

CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTTLLEQLCTGLQQQLDHLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTKMGGDLNSP

≥ 95%, as determined by reducing SDS-PAGE.