IFNT1 Protein, Sheep (P. pastoris, His)
Interferon tau-1 (IFNT1) serves as an important paracrine hormone that initiates maternal recognition of pregnancy. After interacting with endometrial receptors, possibly type I interferon receptors, IFNT1 blocks estrogen receptor expression and prevents estrogen-induced upregulation of oxytocin receptor expression. IFNT1 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived Interferon tau-1/IFNT1 protein, expressed by P. pastoris, with C-6*His labeled tag.
- Species: Sheep
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Interferon tau-1 (IFNT1) serves as an important paracrine hormone that initiates maternal recognition of pregnancy. After interacting with endometrial receptors, possibly type I interferon receptors, IFNT1 blocks estrogen receptor expression and prevents estrogen-induced upregulation of oxytocin receptor expression. IFNT1 Protein, Sheep (P. pastoris, His) is the recombinant sheep-derived Interferon tau-1/IFNT1 protein, expressed by P. pastoris, with C-6*His labeled tag.
Background
Interferon tau-1 (IFNT1) serves as a paracrine hormone pivotal for initiating maternal recognition of pregnancy. Upon interaction with endometrial receptors, likely type I interferon receptors, IFNT1 plays a crucial role in blocking estrogen receptor expression, effectively impeding the estrogen-induced upregulation of oxytocin receptor expression in the endometrium. This mechanism results in the suppression of pulsatile endometrial release of the luteolytic hormone prostaglandin F2-alpha, thereby preventing the regression of the corpus luteum (luteolysis) and facilitating the maintenance of ovarian cyclicity. Additionally, IFNT1, possibly through a direct impact on prostaglandin synthesis, sustains ovarian progesterone secretion, stimulating the endometrial secretion of nutrients necessary for conceptus growth. Notably, IFNT1 exhibits exceptional antiviral and antiproliferative potency, coupled with low cytotoxicity, high antiluteolytic activity, and immunomodulatory properties. A distinctive feature is its lack of virally inducibility in contrast to other interferons.
Technical Parameters
-
Species Sheep
-
Source P. pastoris
-
Tag C-6*His
-
Accession
P56828 (C24-P195)
-
Gene ID100144750
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Interferon tau-1; IFN-tau-1; Antiluteolysin; Trophoblast antiluteolytic protein; Trophoblast protein 1; TP-1; Trophoblastin; IFNT1; OTP
-
AA Sequence
CYLSRKLMLDARENLKLLDRMNRLSPHSCLQDRKDFGLPQEMVEGDQLQKDQAFPVLYEMLQQSFNLFYTEHSSAAWDTTLLEQLCTGLQQQLDHLDTCRGQVMGEEDSELGNMDPIVTVKKYFQGIYDYLQEKGYSDCAWEIVRVEMMRALTVSTTLQKRLTKMGGDLNSP
-
Predicted Molecular Mass
21.4 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
