1. Recombinant Proteins
  2. Fc Receptors
  3. Immunoglobulin Fc Region
  4. IgE
  5. IgE Protein, Human (322a.a, HEK293, His)

IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation. IgE Protein, Human (322a.a, HEK293, His) is the recombinant human-derived IgE protein, expressed by HEK293, with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
100 μg 견적 받기 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   견적 받기  
Synthetic products have potential research and development risk.

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

IgE protein is an important immunoglobulin component that participates in the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation. IgE Protein, Human (322a.a, HEK293, His) is the recombinant human-derived IgE protein, expressed by HEK293, with C-His labeled tag.

Background

The IgE protein, a crucial component of immunoglobulins, functions in both the recognition and effector phases of humoral immunity. Serving as a membrane-bound receptor on B lymphocytes during the recognition phase, IgE plays a pivotal role in triggering clonal expansion and differentiation into immunoglobulin-secreting plasma cells upon specific antigen binding. In the effector phase, secreted IgE mediates immune responses through two Fc receptors, FCER1A:MS4A2:FCGR1A and FCER2, which, upon antigen cross-linking, initiate signaling pathways leading to immune cell activation. IgE facilitates immediate hypersensitivity responses against allergens and defends against helminth parasites, bacteria, and venom toxicity. Dysregulation can lead to harmful allergic reactions and anaphylaxis. IgE stimulates mast cells, basophils, and eosinophils to release inflammatory mediators, contributing to tissue remodeling and cytotoxicity against microbes. On macrophages, IgE induces intracellular killing of parasites and activates antitumor functions, including antibody-dependent cytotoxicity and proinflammatory responses. Additionally, IgE plays a role in B cell antigen uptake and presentation to T cells.

Species

Human

Source

HEK293

Tag

C-His

Accession

P01854 (S106-G427)

Gene ID

3497

Molecular Construction
N-term
IgE (S106-G427)
Accession # P01854
His
C-term
Protein Length

Partial

Synonyms
Ig epsilon chain C region; IgE
AA Sequence

SRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPG

Predicted Molecular Mass
37.6 kDa.
분자량

Approximately 45-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

IgE Protein, Human (322a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

IgE Protein, Human (322a.a, HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
IgE Protein, Human (322a.a, HEK293, His)
Cat. No.:
HY-P704671
수량:
MCE Japan Authorized Agent: