IgE Protein, Human (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

IgE protein is an important immunoglobulin component involved in both the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation. IgE Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant biotinylated IgE protein expressed by HEK293 and tagged with C-Avi and C-His.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IgE protein is an important immunoglobulin component involved in both the recognition and effector phases of humoral immunity. As a membrane-bound receptor on B lymphocytes, IgE triggers clonal expansion upon antigen binding, leading to plasma cell differentiation. IgE Protein, Human (Biotinylated, HEK293, His-Avi) is a recombinant biotinylated IgE protein expressed by HEK293 and tagged with C-Avi and C-His.

Background

The IgE protein, a crucial component of immunoglobulins, functions in both the recognition and effector phases of humoral immunity. Serving as a membrane-bound receptor on B lymphocytes during the recognition phase, IgE plays a pivotal role in triggering clonal expansion and differentiation into immunoglobulin-secreting plasma cells upon specific antigen binding. In the effector phase, secreted IgE mediates immune responses through two Fc receptors, FCER1A:MS4A2:FCGR1A and FCER2, which, upon antigen cross-linking, initiate signaling pathways leading to immune cell activation. IgE facilitates immediate hypersensitivity responses against allergens and defends against helminth parasites, bacteria, and venom toxicity. Dysregulation can lead to harmful allergic reactions and anaphylaxis. IgE stimulates mast cells, basophils, and eosinophils to release inflammatory mediators, contributing to tissue remodeling and cytotoxicity against microbes. On macrophages, IgE induces intracellular killing of parasites and activates antitumor functions, including antibody-dependent cytotoxicity and proinflammatory responses. Additionally, IgE plays a role in B cell antigen uptake and presentation to T cells.

Verified Bioactivity

Immobilized Human Fc epsilon RI alpha, hFc Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human IgE, His Avi Tag with the EC50 of 10-40 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IgE (C209-K428)
      Accession # P01854-1
    • His-Avi
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    IGHE; Ig Epsilon Chain C Region; Immunoglobulin Heavy Constant Epsilon; Immunoglobulin Epsilon; Constant Region Of Heavy Chain Of IgE; IgE; Ig Epsilon Chain C Region ND

  • AA Sequence

    CLATGYFPEPVMVTWDTGSLNGTTMTLPATTLTLSGHYATISLLTVSGAWAKQMFTCRVAHTPSSTDWVDNKTFSVCSRDFTPPTVKILQSSCDGGGHFPPTIQLLCLVSGYTPGTINITWLEDGQVMDVDLSTASTTQEGELASTQSELTLSQKHWLSDRTYTCQVTYQGHTFEDSTKKCADSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSK

  • Predicted Molecular Mass

    27.8 kDa

  • Molecular Weight

    Approximately 32-38 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00