1. Recombinant Proteins
  2. IGF-I/IGF-1 Protein, Mouse (His)

IGF-I/IGF-1 Protein, Mouse (His)

Cat. No.: HY-P70698
Handling Instructions

IGF-I/IGF-1 Protein, Mouse (His) is a mitogenic cytokine, binds to IGF type 1 receptor, and modulates growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. IGF1 also mediates neuroprotective mechanism.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
50 μg $60 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
IGF1; IGF-1; insulin-like growth factor 1; Insulin-like growth factor I; Somatomedin C; somatomedin-C
Species

Mouse

Source

E. coli

Accession

P05017 (G49-A118)

Gene ID

16000

Molecular Weight

Approximately 12.0 kDa

AA Sequence

GPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM NaAc, pH 4.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Background

Insulin-like growth factor (IGF) system has been shown to modulate growth in many tissues, such as nervous tissue, lymphoid tissue, reproductive tissue, smooth muscle, endothelium, and bone. Insulin-like Growth factor-1 (IGF-I) is produced by osteoblasts, and its mitogenic effects are mediated by their binding to the IGF plasma membrane receptors. The IGF type 1 receptor binding to both IGF-I and IGF-II, is thought to be the predominate receptor involved in mediating the effects of these growth factors in most cell types, including osteoblasts[1]. Insulin-like growth factor-1 (IGF-1) is a neurotrophic factor capable of mediating neuroprotective and neuroplasticity mechanisms. Targeted overexpression of IGF-1 enhances the generation of hippocampal newborn neurons in brain-injured mice[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IGF-I/IGF-1 Protein, Mouse (His)
Cat. No.:
HY-P70698
Quantity:
MCE Japan Authorized Agent: