IGF-I Protein, Salmon
Based on 1 Customer Validation
IGF-I protein is similar to insulin and exerts effective growth-promoting activity as a ligand of IGF1R. Binding to the α subunit of IGF1R activates intrinsic tyrosine kinase, triggering autophosphorylation of the β subunit. IGF-I Protein, Salmon is the recombinant IGF-I protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
IGF-I protein is similar to insulin and exerts effective growth-promoting activity as a ligand of IGF1R. Binding to the α subunit of IGF1R activates intrinsic tyrosine kinase, triggering autophosphorylation of the β subunit. IGF-I Protein, Salmon is the recombinant IGF-I protein, expressed by E. coli , with tag free.
The IGF-I protein, structurally and functionally related to insulin, exhibits significantly higher growth-promoting activity. Serving as a ligand for IGF1R, it binds to the alpha subunit of IGF1R, triggering the activation of the intrinsic tyrosine kinase activity. This activation leads to the autophosphorylation of tyrosine residues in the beta subunit, initiating a cascade of downstream signaling events that activate the PI3K-AKT/PKB and Ras-MAPK pathways. IGF-I also binds to integrins, forming a ternary complex with integrins and IGFR1, which proves essential for IGF1 signaling. This intricate molecular interaction highlights the multifaceted role of IGF-I in mediating cellular responses and growth-promoting functions.
Measure by its ability by a dose-response proliferation assay using human FDC-P1 cells. The ED50 for this effect is <15 ng/mL. The specific activity of this protein is > 6.7 × 104 IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
Q02815 (G45-A114)
-
Gene ID100136741
-
Molecular Construction
-
N-term
-
IGF-I (G45-A114)
Accession # Q02815 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IGF1; Somatomedin-C; Insulin Like Growth Factor 1; IGF1A; IGF-I; MGF; Insulin-Like Growth Factor 1; Insulin-Like Growth Factor IB; Insulin-Like Growth Factor I; Insulin-Like Growth Factor-I; IGFI; Alternative Protein IGF1; IGF; Somatomedin C; Insulin-Like
-
AA Sequence
GPETLCGAELVDTLQFVCGERGFYFSKPTGYGPSSRRSHNRGIVDECCFQSCELRRLEMYCAPVKSGKAA
-
Molecular Weight
Approximately 8 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.
< 0.2 EU/μg of protein by gel clotting method
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
