1. Recombinant Proteins
  2. Receptor Proteins
  3. TMEM219/IGFBP-3R Protein, Mouse (HEK293, Fc)

The IGFBP-3R protein was identified as an IGFBP3-specific cell death receptor and becomes a potential mediator of caspase-8-dependent apoptosis upon ligand binding. This receptor actively interacts with IGFBP3, forming a key molecular connection that may initiate the apoptotic signaling cascade. TMEM219/IGFBP-3R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IGFBP-3R protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IGFBP-3R protein was identified as an IGFBP3-specific cell death receptor and becomes a potential mediator of caspase-8-dependent apoptosis upon ligand binding. This receptor actively interacts with IGFBP3, forming a key molecular connection that may initiate the apoptotic signaling cascade. TMEM219/IGFBP-3R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IGFBP-3R protein, expressed by HEK293 , with C-hFc labeled tag.

Background

IGFBP-3R, a cell death receptor specific for insulin-like growth factor binding protein 3 (IGFBP3), is implicated in mediating caspase-8-dependent apoptosis upon ligand binding. This receptor interacts directly with IGFBP3, suggesting a key role in transducing signals related to cell survival and death pathways. The binding of IGFBP3 to IGFBP-3R may trigger apoptotic cascades, potentially involving caspase-8. This interaction between IGFBP-3R and caspase-8 underscores the potential involvement of this receptor in regulating apoptotic processes.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9D123-1 (G39-R204)

Gene ID
Protein Length

Extracellular Domain

Synonyms
IGFBP-3R; GFBP3R; LOC124446; TMEM219
AA Sequence

GFLLTHTTGLRSPDIPQDWVSFLRSFGQLSLCPMNETVTGTWQGPHVVGLLTTLNFGDGPDRNKTQTFQAKIHGSQIGLTGSSAGESVLVTARVASGRTPGTCLYFSGVPKVLPSSQPPISCSEEGVGNATLSPVMGEECVRVWSHERLVLTELLTSEELALCGSR

Predicted Molecular Mass
44.4 kDa
Molecular Weight

Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TMEM219/IGFBP-3R Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TMEM219/IGFBP-3R Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMEM219/IGFBP-3R Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77697
Quantity:
MCE Japan Authorized Agent: