TMEM219/IGFBP-3R Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
The IGFBP-3R protein was identified as an IGFBP3-specific cell death receptor and becomes a potential mediator of caspase-8-dependent apoptosis upon ligand binding. This receptor actively interacts with IGFBP3, forming a key molecular connection that may initiate the apoptotic signaling cascade. TMEM219/IGFBP-3R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IGFBP-3R protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IGFBP-3R protein was identified as an IGFBP3-specific cell death receptor and becomes a potential mediator of caspase-8-dependent apoptosis upon ligand binding. This receptor actively interacts with IGFBP3, forming a key molecular connection that may initiate the apoptotic signaling cascade. TMEM219/IGFBP-3R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IGFBP-3R protein, expressed by HEK293 , with C-hFc labeled tag.
Background
IGFBP-3R, a cell death receptor specific for insulin-like growth factor binding protein 3 (IGFBP3), is implicated in mediating caspase-8-dependent apoptosis upon ligand binding. This receptor interacts directly with IGFBP3, suggesting a key role in transducing signals related to cell survival and death pathways. The binding of IGFBP3 to IGFBP-3R may trigger apoptotic cascades, potentially involving caspase-8. This interaction between IGFBP-3R and caspase-8 underscores the potential involvement of this receptor in regulating apoptotic processes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9D123-1 (G39-R204)
-
Protein Length
Extracellular Domain
-
Synonyms
TMEM219; Insulin-Like Growth Factor-Binding Protein 3 Receptor; Transmembrane Protein 219; Testicular Tissue Protein Li 203; IGFBP-3R; IGFBP3R
-
AA Sequence
GFLLTHTTGLRSPDIPQDWVSFLRSFGQLSLCPMNETVTGTWQGPHVVGLLTTLNFGDGPDRNKTQTFQAKIHGSQIGLTGSSAGESVLVTARVASGRTPGTCLYFSGVPKVLPSSQPPISCSEEGVGNATLSPVMGEECVRVWSHERLVLTELLTSEELALCGSR
-
Predicted Molecular Mass
44.4 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
