Copy Link Print Information

IGFBP-1 Protein, Rhesus Macaque (HEK293, His)

Customer Review

Based on 1 Customer Validation

IGFBP-1 Protein, a member of the insulin-like growth factor-binding protein (IGFBP) family, extends IGFs' half-life and modulates their growth-promoting effects on cell culture, inhibiting or stimulating these responses. Crucially, it alters the interaction between IGFs and their cell surface receptors and promotes cell migration. Notably versatile, IGFBP-1 shows equal binding affinity for both IGF1 and IGF2, underscoring its diverse role in modulating the biological activities of insulin-like growth factors. IGFBP-1 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IGFBP-1 Protein, Rhesus Macaque (HEK293, His)
  • Experimental Validation Results for IGFBP-1 Protein, Rhesus Macaque (HEK293, His)
  • IGFBP-1 Protein, Rhesus Macaque (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IGFBP-1 Protein, a member of the insulin-like growth factor-binding protein (IGFBP) family, extends IGFs' half-life and modulates their growth-promoting effects on cell culture, inhibiting or stimulating these responses. Crucially, it alters the interaction between IGFs and their cell surface receptors and promotes cell migration. Notably versatile, IGFBP-1 shows equal binding affinity for both IGF1 and IGF2, underscoring its diverse role in modulating the biological activities of insulin-like growth factors. IGFBP-1 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived IGFBP-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Insulin-like growth factor-binding protein 1 (IGFBP-1), a member of the insulin-like growth factor-binding protein (IGFBP) family, contributes to the regulation of IGFs by extending their half-life and modulating their growth-promoting effects on cell culture, either inhibiting or stimulating these effects. This protein plays a crucial role in altering the interaction between IGFs and their cell surface receptors. Additionally, IGFBP-1 demonstrates the ability to promote cell migration, indicating its involvement in cellular processes beyond growth regulation. Notably, it exhibits equal binding affinity for both IGF1 and IGF2, highlighting its versatile role in modulating the biological activities of insulin-like growth factors[1].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Rhesus IGFBP1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant human IGF1. The ED50 for this effect is 81.21 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Rhesus IGFBP1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant human IGF1. The ED50 for this effect is 81.21 ng/mL.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-6*His
  • Accession

    XP_001085935 (A48-N281)

  • Gene ID
    696994  [NCBI]
  • Molecular Construction
    • N-term
    • IGFBP-1 (A48-N281)
      Accession # XP_001085935
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    IGFBP1; Alpha-Pregnancy-Associated Endometrial Globulin; Prev. IBP1; Amniotic Fluid Binding Protein; PP12; Binding Protein-28; Insulin-Like Growth Factor-Binding Protein 1; Binding Protein-26; IGF-Binding Protein 1; Binding Protein-25; Placental Protein 1

  • AA Sequence

    APWQCAPCSAEKLALCPPVPASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQDSDASASNAEAAGSPESPESTEITEEELLDNFHLMAPSEEDHSTLWDAIGTYDSSKAVHVTNVKKWKEPCRIELYRVVESLTKAQETSGEDISKFYLPNCNKNGFYHSRQCETSLAGEERLCWCVYPWNGKRIPGSPEIRGDPNCQTYFNVQN

  • Predicted Molecular Mass

    25.3 kDa

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Rhesus IGFBP1 Protein is immobilized at 10 µg/mL (100 µL/well) can bind Biotinylated Recombinant human IGF1. The ED50 for this effect is 81.21 ng/mL.

  • IGFBP-1 Protein, Rhesus Macaque (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for IGFBP-1 Protein, Rhesus Macaque (HEK293, His)
  • Experimental Validation Results for IGFBP-1 Protein, Rhesus Macaque (HEK293, His)
  • IGFBP-1 Protein, Rhesus Macaque (HEK293, His) Product Image