IL-1 beta Protein, Cynomolgus (Biotinylated, His, Avi)
IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple responses, including prostaglandin synthesis, neutrophil and T cell activation, B cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote Th1 IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Cynomolgus (Biotinylated, His, Avi) is the recombinant cynomolgus-derived IL-1 beta protein, expressed by E. coli, with N-Avi and N-His labeled tag.
- Species: Cynomolgus
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple responses, including prostaglandin synthesis, neutrophil and T cell activation, B cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote Th1 IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Cynomolgus (Biotinylated, His, Avi) is the recombinant cynomolgus-derived IL-1 beta protein, expressed by E. coli, with N-Avi and N-His labeled tag.
Background
IL-1 beta Protein is a potent pro-inflammatory cytokine initially discovered as a major endogenous pyrogen. It induces prostaglandin synthesis, neutrophil activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. IL-1 beta Protein also promotes Th17 differentiation of T-cells and synergizes with IL12 to induce IFNG synthesis from Th1 cells. Additionally, it plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. IL-1 beta Protein is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. It exists as a monomer and interacts with MEFV.
Technical Parameters
-
Species Cynomolgus
-
Source E. coli
-
Tag N-Avi;N-8*His
-
Accession
A0A2K5VDC7 (A117-S268)
-
Gene ID/
-
Molecular Construction
-
N-term
-
8*His-Avi
-
IL-1 beta (A117-S268)
Accession # A0A2K5VDC7 -
C-term
-
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
IL1B; IL-1B; Interleukin 1 Beta; Multifunctional Fusion Protein; IL1F2; Pro-Interleukin-1-Beta; Interleukin-1 Beta; Preinterleukin 1 Beta; IL1-BETA; Interleukin 1beta; IL-1 Beta; IL1beta; Catabolin; IL-1
-
AA Sequence
APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVS
-
Predicted Molecular Mass
20.1 kDa
-
Molecular Weight
Approximately 22-24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
