IL-1 beta Protein, Cynomolgus (Biotinylated, His, Avi)

IL-1 beta protein is a potent proinflammatory cytokine and endogenous pyrogen that induces multiple responses, including prostaglandin synthesis, neutrophil and T cell activation, B cell activation, and fibroblast proliferation. It promotes Th17 differentiation, synergizes with IL12 to promote Th1 IFNG synthesis, and induces VEGF production through TNF and IL6 to promote angiogenesis. IL-1 beta Protein, Cynomolgus (Biotinylated, His, Avi) is the recombinant cynomolgus-derived IL-1 beta protein, expressed by E. coli, with N-Avi and N-His labeled tag.

IL-1 beta Protein is a potent pro-inflammatory cytokine initially discovered as a major endogenous pyrogen. It induces prostaglandin synthesis, neutrophil activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. IL-1 beta Protein also promotes Th17 differentiation of T-cells and synergizes with IL12 to induce IFNG synthesis from Th1 cells. Additionally, it plays a role in angiogenesis by inducing VEGF production synergistically with TNF and IL6. IL-1 beta Protein is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released in the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. It exists as a monomer and interacts with MEFV.

Cynomolgus

E. coli

N-Avi;N-8*His

A0A2K5VDC7 (A117-S268)

/

Partial

Biotin

APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVS

Approximately 22-24 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.