IL-1 beta Protein, Human (C-His)
Based on 1 publication(s) in Google Scholar
IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (C-His) is the recombinant human-derived IL-1 beta protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (C-His) is the recombinant human-derived IL-1 beta protein, expressed by E. coli , with C-6*His labeled tag.
Background
IL-1 beta Protein stands as a potent pro-inflammatory cytokine, recognized for its diverse roles in orchestrating immune responses. Originally identified as a major endogenous pyrogen, IL-1 beta induces a cascade of inflammatory events, including prostaglandin synthesis, neutrophil influx and activation, T-cell and B-cell activation, cytokine production, as well as fibroblast proliferation and collagen production. It plays a pivotal role in immune cell differentiation, promoting Th17 differentiation of T-cells and synergizing with IL-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Additionally, IL-1 beta contributes to angiogenesis by inducing VEGF production, working synergistically with TNF and IL-6. Notably, it plays a key role in transducing inflammation downstream of pyroptosis, being specifically released into the extracellular milieu through the gasdermin-D (GSDMD) pore. In the context of microbial infection, IL-1 beta acts as a sensor of S. pyogenes infection in the skin, undergoing cleavage and activation by the pyogenes SpeB protease, leading to an inflammatory response that curtails bacterial growth during invasive skin infection. However, the cleavage of IL-1 beta by SpeB has a dual role, promoting streptococcal infection of the nasopharynx by disrupting colonization resistance mediated by the microbiota.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Transl Med
Vascular restenosis following paclitaxel-coated balloon therapy is attributable to NLRP3 activation and LIN9 upregulation. [Abstract]2024 Sep 27;22(1):871. PMID: 39334121
IL-1 beta Protein, Human (C-His) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2024 Sep 27;22(1):871. [Abstract]
To assess the impact of IL-1β on PTX sensitivity, the EDU assay and Transwell assay after treatment with IL-1β (IL-1 beta Protein, Human (C-His), 10 ng/mL) alone or in combination with PTX.
IL-1 beta Protein, Human (C-His) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2024 Sep 27;22(1):871. [Abstract]
Cells were treated with IL-1β (IL-1 beta Protein, Human (C-His), 10 ng/mL) for 24 h, followed by an additional 24-h treatment with PTX, by cell cycle analysis the proportions of cells at different phases of the cell cycle were quantified.
IL-1 beta Protein, Human (C-His) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2024 Sep 27;22(1):871. [Abstract]
A volcano plot was employed to visualize the differential gene expression in VSMCs between the control group (n = 3) and the group treated with IL-1β (IL-1 beta Protein, Human (C-His), 10ng/mL for 24 h, n = 3).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P01584 (A117-S269)
-
Gene ID3553
-
Molecular Construction
-
N-term
-
IL-1β (A117-S269)
Accession # P01584 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL1B; IL-1B; Interleukin 1 Beta; Multifunctional Fusion Protein; IL1F2; Pro-Interleukin-1-Beta; Interleukin-1 Beta; Preinterleukin 1 Beta; IL1-BETA; Interleukin 1beta; IL-1 Beta; IL1beta; Catabolin; IL-1
-
AA Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
-
Predicted Molecular Mass
17.3 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)