Copy Link Print Information

IL-1 beta Protein, Human (C-His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (C-His) is the recombinant human-derived IL-1 beta protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-1 beta Protein, Human (C-His)
  • Experimental Validation Results for IL-1 beta Protein, Human (C-His)
  • Experimental Validation Results for IL-1 beta Protein, Human (C-His)
  • Experimental Validation Results for IL-1 beta Protein, Human (C-His)
  • Experimental Validation Results for IL-1 beta Protein, Human (C-His)
  • IL-1 beta Protein, Human (C-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-1 beta protein is a potent proinflammatory cytokine that plays multiple roles in immune responses. It induces inflammatory events including prostaglandin synthesis, neutrophil activation, and cytokine production. IL-1 beta Protein, Human (C-His) is the recombinant human-derived IL-1 beta protein, expressed by E. coli , with C-6*His labeled tag.

Background

IL-1 beta Protein stands as a potent pro-inflammatory cytokine, recognized for its diverse roles in orchestrating immune responses. Originally identified as a major endogenous pyrogen, IL-1 beta induces a cascade of inflammatory events, including prostaglandin synthesis, neutrophil influx and activation, T-cell and B-cell activation, cytokine production, as well as fibroblast proliferation and collagen production. It plays a pivotal role in immune cell differentiation, promoting Th17 differentiation of T-cells and synergizing with IL-12 to induce IFNG synthesis from T-helper 1 (Th1) cells. Additionally, IL-1 beta contributes to angiogenesis by inducing VEGF production, working synergistically with TNF and IL-6. Notably, it plays a key role in transducing inflammation downstream of pyroptosis, being specifically released into the extracellular milieu through the gasdermin-D (GSDMD) pore. In the context of microbial infection, IL-1 beta acts as a sensor of S. pyogenes infection in the skin, undergoing cleavage and activation by the pyogenes SpeB protease, leading to an inflammatory response that curtails bacterial growth during invasive skin infection. However, the cleavage of IL-1 beta by SpeB has a dual role, promoting streptococcal infection of the nasopharynx by disrupting colonization resistance mediated by the microbiota.

Verified Bioactivity

Measured in a cell proliferation assay using CTLL-2 cells. The ED50 for this effect is 1.67 pg/mL, corresponding to a specific activity is 5.99×108 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P01584 (A117-S269)

  • Gene ID
    3553
  • Molecular Construction
    • N-term
    • IL-1β (A117-S269)
      Accession # P01584
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL1B; IL-1B; Interleukin 1 Beta; Multifunctional Fusion Protein; IL1F2; Pro-Interleukin-1-Beta; Interleukin-1 Beta; Preinterleukin 1 Beta; IL1-BETA; Interleukin 1beta; IL-1 Beta; IL1beta; Catabolin; IL-1

  • AA Sequence

    APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

  • Predicted Molecular Mass

    17.3 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using CTLL-2 cells.The ED50 for this effect is 1.67 pg/mL, corresponding to a specific activity is 5.99×108 units/mg.

  • 1/16

    IL-1 beta Protein, Human (C-His) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2024 Sep 27;22(1):871. [Abstract]

    Customer Validation
     To assess the impact of IL-1β on PTX sensitivity, the EDU assay and Transwell assay after treatment with IL-1β (IL-1 beta Protein, Human (C-His), 10 ng/mL) alone or in combination with PTX.

  • 1/16

    IL-1 beta Protein, Human (C-His) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2024 Sep 27;22(1):871. [Abstract]

    Customer Validation
     Cells were treated with IL-1β (IL-1 beta Protein, Human (C-His), 10 ng/mL) for 24 h, followed by an additional 24-h treatment with PTX, by cell cycle analysis the proportions of cells at different phases of the cell cycle were quantified.

  • 1/16

    IL-1 beta Protein, Human (C-His) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2024 Sep 27;22(1):871. [Abstract]

    Customer Validation
     A volcano plot was employed to visualize the differential gene expression in VSMCs between the control group (n = 3) and the group treated with IL-1β (IL-1 beta Protein, Human (C-His), 10ng/mL for 24 h, n = 3).

  • IL-1 beta Protein, Human (C-His) Product Image
    1/16
  • Experimental Validation Results for IL-1 beta Protein, Human (C-His)
  • Experimental Validation Results for IL-1 beta Protein, Human (C-His)
  • Experimental Validation Results for IL-1 beta Protein, Human (C-His)
  • Experimental Validation Results for IL-1 beta Protein, Human (C-His)
  • Experimental Validation Results for IL-1 beta Protein, Human (C-His)
  • IL-1 beta Protein, Human (C-His) Product Image

  • IL-1 beta Protein, Human (C-His) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2024 Sep 27;22(1):871. [Abstract]

    To assess the impact of IL-1β on PTX sensitivity, the EDU assay and Transwell assay after treatment with IL-1β (IL-1 beta Protein, Human (C-His), 10 ng/mL) alone or in combination with PTX.

  • IL-1 beta Protein, Human (C-His) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2024 Sep 27;22(1):871. [Abstract]

    Cells were treated with IL-1β (IL-1 beta Protein, Human (C-His), 10 ng/mL) for 24 h, followed by an additional 24-h treatment with PTX, by cell cycle analysis the proportions of cells at different phases of the cell cycle were quantified.

  • IL-1 beta Protein, Human (C-His) purchased from MedChemExpress. Usage Cited in: J Transl Med. 2024 Sep 27;22(1):871. [Abstract]

    A volcano plot was employed to visualize the differential gene expression in VSMCs between the control group (n = 3) and the group treated with IL-1β (IL-1 beta Protein, Human (C-His), 10ng/mL for 24 h, n = 3).