1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Interleukin & Receptors
  4. IL-12 IL-23
  5. IL-12 beta
  6. IL-12 beta Protein, Mouse (Biotinylated, HEK293, His-Avi)

IL-12 beta Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78861
Handling Instructions Technical Support

IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT. IL-12 beta Protein consists of 335 amino acids (M1-S335) with a fibronectin type-III domain (233-324 a.a). IL-12 beta Protein, Mouse (M23-S335) is produced in HEK293 cells with a C-Terminal His- and Avi-tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer[1]. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT[3]. IL-12 beta Protein consists of 335 amino acids (M1-S335) with a fibronectin type-III domain (233-324 a.a). IL-12 beta Protein, Mouse (M23-S335) is produced in HEK293 cells with a C-Terminal His- and Avi-tag.

Background

IL-12 beta Protein, as known as IL12 p40 subunit or IL-12B, heterodimerizes with the IL-12 p35 subunit (IL-12A) to form IL-12 and with the IL23 p19 subunit to form IL-23, exerting different regulating functions[1].
IL-12 and IL23 belong to IL-12 family, are involved in proinflammatory responses and expressed by activated macrophages that serve as an essential inducer of Th1 cells development[2].
IL-12 signals via IL-12Rβ1 and IL-12Rβ2 mediated by p-STAT4, whereas IL-23 signals via IL-12Rβ1 and IL-23R mediated by p-STAT1 and p-STAT3[3].
The sequence of amino acids in IL-12 beta proteins of mouse is very different from human (69.04%), but shows high similarity with rat (92.24%).
Interleukin 12 (IL-12) family have been known to be inflammatory factors, induce autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis[4].

In Vitro

Mouse IL-12 (mIL-12) has a significant stimulating effect on CTLL-2 cells and results 65-70% of CTLL2 cell population having mIL12 receptors[5].
Mouse IL-12 (mIL-12) (0.19-50 U/mL; 24-72 h) inhibits CTLL-2 cells proliferation without cell-lethal effect at 2 U/mL for 72 h[5].

In Vivo

IL12b-/- (p40-deficient) mice exhibits decreasing blood neutrophil numbers and an absence of serum levels of IL-17A[6].
  IL12b-/-/Itgb2-/- (lacking adhesion molecules like beta2-integrins) mice has a reducing tissue mRNA expression of IL-17A compared with Itgb2-/- controls and reduces total number of CD3+ IL-17A-producing Tn cells in the spleen and lamina propria[6].
IL12b contributes to Aβ42-induced neuronal damage and cognitive decline in APPPS1 Alzheimer's disease mouse model[7].

Biological Activity

Immobilized Biotinylated Mouse IL-12B His-Avi at 1 μg/mL (100 μL/well) on streptavidin precoated (0.5 μg/well) plate can bind Human IL-12 R beta 1 Fc with a linear range of 0.02-0.156 μg/mL.

Species

Mouse

Source

HEK293

Tag

C-Avi;C-His

Accession

P43432 (M23-S335)

Gene ID
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
IL12B; CLMF; CLMF2; NKSF; NKSF2; p40
AA Sequence

MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Molecular Weight

Approximately 45 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-12 beta Protein, Mouse (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-12 beta Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78861
Quantity:
MCE Japan Authorized Agent: