1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-12 IL-23
  5. IL-12 beta
  6. IL-12 beta Protein, Mouse (HEK293)

IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT. IL-12 beta Protein consists of 335 amino acids (M1-S335) with a fibronectin type-III domain (233-324 a.a). IL-12 beta Protein, Mouse (M1-S335) is produced in HEK293 cells with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-12 beta Protein, also known as natural killer cell stimulatory factor 2, is a common subunit (p40) of IL-12 and IL-23. IL-12 is a inflammatory factor expressed by activated macrophages, and involves in Th1-type immune response against cancer[1]. IL-12 beta Protein located outside the cell membrane, involves in singalling mediated by Jak-STAT[3]. IL-12 beta Protein consists of 335 amino acids (M1-S335) with a fibronectin type-III domain (233-324 a.a). IL-12 beta Protein, Mouse (M1-S335) is produced in HEK293 cells with tag free.

Background

IL-12 beta Protein, as known as IL12 p40 subunit or IL-12B, heterodimerizes with the IL-12 p35 subunit (IL-12A) to form IL-12 and with the IL23 p19 subunit to form IL-23, exerting different regulating functions[1].
IL-12 and IL23 belong to IL-12 family, are involved in proinflammatory responses and expressed by activated macrophages that serve as an essential inducer of Th1 cells development[2].
IL-12 signals via IL-12Rβ1 and IL-12Rβ2 mediated by p-STAT4, whereas IL-23 signals via IL-12Rβ1 and IL-23R mediated by p-STAT1 and p-STAT3[3].
The sequence of amino acids in IL-12 beta proteins of mouse is very different from human (69.04%), but shows high similarity with rat (92.24%).
Interleukin 12 (IL-12) family have been known to be inflammatory factors, induce autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis[4].

In Vitro

Mouse IL-12 (mIL-12) has a significant stimulating effect on CTLL-2 cells and results 65-7% of CTLL2 cell population having mIL12 receptors[5].
Mouse IL-12 (mIL-12) (.19-5 U/mL; 24-72 h) inhibits CTLL-2 cells proliferation without cell-lethal effect at 2 U/mL for 72 h[5].

In Vivo

IL12b-/- (p4-deficient) mice exhibits decreasing blood neutrophil numbers and an absence of serum levels of IL-17A[6].
  IL12b-/-/Itgb2-/- (lacking adhesion molecules like beta2-integrins) mice has a reducing tissue mRNA expression of IL-17A compared with Itgb2-/- controls and reduces total number of CD3+ IL-17A-producing Tn cells in the spleen and lamina propria[6].
IL12b contributes to Aβ42-induced neuronal damage and cognitive decline in APPPS1 Alzheimer's disease mouse model[7].

Species

Mouse

Source

HEK293

Tag

Tag Free

Accession

P43432 (M23-S335)

Gene ID
Molecular Construction
N-term
IL-12β (M23-S335)
Accession # P43432
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-12 subunit beta; IL-12B; CLMF p40; IL-12 subunit p40; NKSF2; IL12B
AA Sequence

MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Predicted Molecular Mass
36.6 kDa
Molecular Weight

Approximately 46 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-12 beta Protein, Mouse (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-12 beta Protein, Mouse (HEK293)
Cat. No.:
HY-P73161
Quantity:
MCE Japan Authorized Agent: