IL-13R alpha 2 Protein, Rat (HEK293, His)

IL-13R alpha 2 Protein, functioning as a monomer, exhibits strong affinity for binding to interleukin-13 (IL-13), thereby playing a crucial role in mediating the biological effects of IL-13 and regulating various cellular processes. IL-13R alpha 2 Protein, Rat (HEK293, His) is the recombinant rat-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-13R alpha 2 Protein, functioning as a monomer, exhibits strong affinity for binding to interleukin-13 (IL-13), thereby playing a crucial role in mediating the biological effects of IL-13 and regulating various cellular processes. IL-13R alpha 2 Protein, Rat (HEK293, His) is the recombinant rat-derived IL-13R alpha 2 protein, expressed by HEK293 , with C-His labeled tag.

Background

The IL-13R alpha 2 protein, as a monomer, demonstrates a high affinity for binding to interleukin-13 (IL-13). This interaction plays a crucial role in mediating the biological effects of IL-13 and contributes to the regulation of various cellular processes.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit IL-13-dependent proliferation of TF‑1 human erythroleukemic cells. The ED50 for this effect is 0.0939 µg/mL in the presence of 8 ng/mL of recombinant mouse IL-13, corresponding to a specific activity is 1.06×104 U/mg.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-13Rα2 (L24-K336)
      Accession # Q8VHK6
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    IL13RA2; IL-13R Subunit Alpha-2; Interleukin 13 Receptor Subunit Alpha 2; IL-13R-Alpha-2; CD213a2; IL-13RA2; IL-13R; Interleukin-13 Receptor Alpha 2 Variant; IL13BP; Interleukin 13 Receptor Alpha 2 Chain; CT19; Interleukin 13 Binding Protein; Interleukin-

  • AA Sequence

    LEIKVNPPQDFEILDPGLLGYLYLQWKPPVVMDNFKECKLEYELKYRNVDSDSWKTIITRNLIYKDGFDLNKGIEGKIRTHLSEHCTNGSEVQSPWTEASYGIADEGSLGTKIQDMKCIYYNWQYLVCSWKPGKTVHSDTNYTMFFWYEGLDHALQCADYLQDNEKNVGCKLSNLDSSDYKDFFIRVNGSSKLEPIRSSYMVFQLQNIVKPLPPEFLHISVENSIDIRMKWSTPGGPIPPSCYTYEIVVREDDISWESATDKNDMKLKRRANESEDLCFFVRCKINIYCADDGIWSEWSEEECWEGYTGPDSK

  • Predicted Molecular Mass

    37.9 kDa

  • Molecular Weight

    Approximately 44 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00