Copy Link Print Information

IL-18/IL-1F4 Protein, Porcine

Customer Review

Based on 1 Customer Validation

IL-18/IL-1F4 protein is a pro-inflammatory cytokine that is critical in epithelial barrier repair and coordinates immune responses involving Th1 cells and NK cells. IL-18 binds to IL18R1 and IL18RAP to form a ternary complex that activates NF-κ-B and triggers the synthesis of inflammatory mediators. IL-18/IL-1F4 Protein, Porcine is the recombinant Porcine-derived IL-18/IL-1F4 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Porcine
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for IL-18/IL-1F4 Protein, Porcine
  • Experimental Validation Results for IL-18/IL-1F4 Protein, Porcine
  • IL-18/IL-1F4 Protein, Porcine Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-18/IL-1F4 protein is a pro-inflammatory cytokine that is critical in epithelial barrier repair and coordinates immune responses involving Th1 cells and NK cells. IL-18 binds to IL18R1 and IL18RAP to form a ternary complex that activates NF-κ-B and triggers the synthesis of inflammatory mediators. IL-18/IL-1F4 Protein, Porcine is the recombinant Porcine-derived IL-18/IL-1F4 protein, expressed by E. coli , with tag free.

Background

IL-18, a pro-inflammatory cytokine, plays a crucial role in epithelial barrier repair and orchestrates polarized immune responses involving T-helper 1 (Th1) cells and natural killer (NK) cells. Upon binding to IL18R1 and IL18RAP, IL-18 forms a signaling ternary complex that activates NF-kappa-B, triggering the synthesis of inflammatory mediators. It synergizes with IL-12 to induce IFNG synthesis in Th1 cells and NK cells. Notably, IL-18 is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular milieu by passing through the gasdermin-D (GSDMD) pore. At the plasma membrane, IL-18 forms a ternary complex with the ligand-binding receptor subunit IL18R1 and the signaling receptor subunit IL18RAP, initiating intracellular signaling. The interaction with the cargo receptor TMED10 facilitates IL-18's translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion.

Verified Bioactivity

Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells in the presence of TNF-alpha. The ED50 for this effect is 36.31 ng/mL in the presence of 15 pg/mL TNF-alpha, corresponding to a specific activity is 2.754×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells in the presence of TNF-alpha. The ED50 for this effect is 36.31 ng/mL in the presence of 15 pg/mL TNF-alpha, corresponding to a specific activity is 2.754×104 U/mg.

Technical Parameters

  • Species Porcine
  • Source E. coli
  • Tag Tag Free
  • Accession

    O19073 (Y36-N192)

  • Gene ID
    397057  [NCBI]
  • Molecular Construction
    • N-term
    • IL-18 (Y36-N192)
      Accession # O19073
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL18; Interleukin 18 (Interferon-Gamma-Inducing Factor); Interleukin 18; IFN-Gamma-Inducing Factor; IL-18; Interleukin-1 Gamma; IL1F4; Iboctadekin; IGIF; IL-1 Gamma; Interleukin-18; Interferon-Gamma-Inducing Factor; IL-1g; Interferon Gamma-Inducing Factor

  • AA Sequence

    YFGKLEPKLSIIRNLNDQVLFINQGHQAVFEDMPDSDCSDNAPQTVFIIYMYKDSLTRGLAVTISVQCKKMSTLSCKNKTLSFKEMSPPDNIDDEGNDIIFFQRSVPGHDDKIQFESSLYKGYFLACKKENDLFKLILKEKDECGDKSIMFTVQNKN

  • Predicted Molecular Mass

    18 kDa

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 2 mM DTT, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce IFN-gamma secretion by KG-1 human acute myelogenous leukemia cells in the presence of TNF-alpha. The ED50 for this effect is 36.31 ng/mL in the presence of 15 pg/mL TNF-alpha, corresponding to a specific activity is 2.754×104 U/mg.

  • IL-18/IL-1F4 Protein, Porcine Product Image
    1/16
  • Experimental Validation Results for IL-18/IL-1F4 Protein, Porcine
  • Experimental Validation Results for IL-18/IL-1F4 Protein, Porcine
  • IL-18/IL-1F4 Protein, Porcine Product Image