IL-1F10/IL-38 Protein, Mouse (His-SUMO, solution)
Based on 2 publication(s) in Google Scholar
IL-1F10/IL-38 proteins regulate immune responses. IL-1F10/IL-38 Protein, Mouse (His-SUMO, solution) is the recombinant mouse-derived IL-1F10/IL-38 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-1F10/IL-38 proteins regulate immune responses. IL-1F10/IL-38 Protein, Mouse (His-SUMO, solution) is the recombinant mouse-derived IL-1F10/IL-38 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
IL-1F10/IL-38 Protein, exhibiting immunomodulatory activity, operates by influencing cytokine production. While it does not independently induce cytokine production, it plays a regulatory role in the immune response. Notably, IL-1F10/IL-38 reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans, indicating its ability to modulate specific immune pathways. Moreover, it diminishes IL36G-induced production of IL8 by peripheral blood mononuclear cells, highlighting its broader impact on cytokine responses. Conversely, IL-1F10/IL-38 increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS), suggesting its involvement in diverse immune processes. Functioning as a ligand for IL-36R/IL1RL2, IL-1F10/IL-38 engages in intricate interactions, and its binding with the cargo receptor TMED10 facilitates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC), leading to subsequent secretion.
Verified Bioactivity
Measured by its ability to inhibit IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED50 for this effect is 40.04 ng/mL, corresponding to a specific activity is 2.50×104 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Publications (2)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
Q8R459 (M1-R152)
-
Gene ID215274
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
IL-38 (M1-R152)
Accession # Q8R459 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
IL1F10; MGC119832; Interleukin 1 Family Member 10; MGC119833; IL-1HY2; MGC11983; IL1-Theta; IL1HY2; IL-1F10; Interleukin-1 Receptor Antagonist-Like FIL1 Theta; FKSG75; Interleukin 1 Family, Member 10 (Theta); IL-38; Interleukin 1 Family Member 10 (Theta);
-
AA Sequence
MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR
-
Predicted Molecular Mass
28.3 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 50% glycerol.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
