IL-1F10/IL-38 Protein, Mouse (His-SUMO, solution)

IL-1F10/IL-38 proteins regulate immune responses. IL-1F10/IL-38 Protein, Mouse (His-SUMO, solution) is the recombinant mouse-derived IL-1F10/IL-38 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of IL-1F10/IL-38 Protein, Mouse (His-SUMO, solution) is 152 a.a., with molecular weight of ~33 kDa.

IL-1F10/IL-38 Protein, exhibiting immunomodulatory activity, operates by influencing cytokine production. While it does not independently induce cytokine production, it plays a regulatory role in the immune response. Notably, IL-1F10/IL-38 reduces IL22 and IL17A production by T-cells in response to heat-killed Candida albicans, indicating its ability to modulate specific immune pathways. Moreover, it diminishes IL36G-induced production of IL8 by peripheral blood mononuclear cells, highlighting its broader impact on cytokine responses. Conversely, IL-1F10/IL-38 increases IL6 production by dendritic cells stimulated by bacterial lipopolysaccharides (LPS), suggesting its involvement in diverse immune processes. Functioning as a ligand for IL-36R/IL1RL2, IL-1F10/IL-38 engages in intricate interactions, and its binding with the cargo receptor TMED10 facilitates translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC), leading to subsequent secretion.

Measured by its ability to inhibit IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 40.04 ng/mL, corresponding to a specific activity is 2.50×10⁴ U/mg.

• 
  Measured by its ability to inhibit IL-6 secretion by THP-1 human acute monocytic leukemia cells. The ED₅₀ for this effect is 40.04 ng/mL, corresponding to a specific activity is 2.50×10⁴ U/mg.

Mouse

E. coli

N-6*His;N-SUMO

Q8R459 (M1-R152)

215274

MCSLPMARYYIIKDAHQKALYTRNGQLLLGDPDSDNYSPEKVCILPNRGLDRSKVPIFLGMQGGSCCLACVKTREGPLLQLEDVNIEDLYKGGEQTTRFTFFQRSLGSAFRLEAAACPGWFLCGPAEPQQPVQLTKESEPSTHTEFYFEMSR

Approximately 33 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4, 50% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.