IL-20R beta Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24. IL-20R beta Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal hFc-tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24[2]. IL-20R beta Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal hFc-tag.
Background
IL-20R beta (IL-12RB), also known as a beta subunit of IL-20 receptor (IL-20RB), belongs to the type II cytokine receptor family. IL-20R beta is widely expressed with highest levels in skin and testis and highly expressed in psoriatic skin[1].
IL-20R beta forms functional heterodimers with different subunit protein. IL-20R beta serves as the receptor for IL-19, IL-20 and IL-24 by dimerizing with IL20RA, however serves as the receptor for IL-20 and IL-24 by dimerizing with IL-22RA1[2].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1, act function by binding IL-20, and then stimulates a signal transduction pathway through STAT3 in a keratinocyte cell line[1].
However, the expression of both IL-20RB/IL-20RA is found to be upregulated in psoriatic skin lesions on keratinocytes[3].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1 bind to IL-24, induce rapid activation of Stat-1 and Stat-3 transcription factors, which appear to play a role in cell survival and proliferation[4].
The sequence of amino acids in IL-12 beta proteins of mouse is very different from human (64.64%).
In Vitro
IL-2R beta-/- CD8 and CD4 T cells isolated from IL-2R beta-chain-deficient mice is more sensitive to Con A or anti-CD3/CD28 stimulation, results in IFN-γ+ and IL-2 secretion increase in CD8 and CD4 T cells and IL-1 secretion decrease in IL-2R beta-/- CD4 cells[5].
In Vivo
IL-2R beta-chain (IL-2R2) deficient in mice results significantly more Ag-specific CD8 IFN-gamma+ and CD4 IFN-gamma+ T cells developed to locally applied DNA vaccines[5].
Verified Bioactivity
Measured by its binding ability in a functional ELISA.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
E9Q9A6/NP_001028715 (V27-S225)
-
Molecular Construction
-
N-term
-
IL-20Rβ (V27-S225)
Accession # E9Q9A6/NP_001028715 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
IL20RB; Interleukin-20 Receptor Subunit Beta; Prev. FNDC6; IL-20R-Beta; IL-20R2; MGC34923; DIRS1; IL-20RB; Fibronectin Type III Domain Containing 6; Interleukin 20 Receptor Beta; Interleukin 20 Receptor Beta Subunit; Interleukin-20 Receptor II; Interleukin 20 Receptor Subunit Beta; IL-20 Receptor Subunit Beta
-
AA Sequence
VSVLPAPQNLSVQSTNMKHLLMWNPVTQPGETVLYCVEYQGEYESLYMSHIWIPSSQCSPTKSLECDVTDDITATVPYNFRVKAMLGSQTSAWSNLEHPFNRNATVLTPPRMEVTEHGLHLVIELEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPTCVEMQGES
-
Predicted Molecular Mass
23.8 kDa
-
Molecular Weight
Approximately 30-38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (263 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
[1]. Blumberg H, et al. Interleukin 20: discovery, receptor identification, and role in epidermal function. Cell. 2001 Jan 12;10 4(1):9-19. [Content Brief]
[2]. Wegenka UM. IL-20: biological functions mediated through two types of receptor complexes. Cytokine Growth Factor Rev. 2010 Oct;21(5):353-63. [Content Brief]
[3]. Sheikh F, et al. Cutting edge: IL-26 signals through a novel receptor complex composed of IL-20 receptor 1 and IL-10 receptor 2. J Immunol. 2004 Feb 15;172(4):2006-10. [Content Brief]
[4]. Wang M, et al. Interleukin-24 and its receptors. Immunology. 2005 Feb;114(2):166-70. [Content Brief]
[5]. Wahl C, et al. IL-20 receptor 2 signaling down-regulates antigen-specific T cell responses. J Immunol. 2009 Jan 15;182(2):802-10. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
