IL-20R beta Protein, Mouse (HEK293, His)

IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway^[1]. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24^[2]. IL-20R beta Protein, Human (HEK293, Fc) is produced in HEK293 cells with a C-Terminal hFc-tag.

IL-20R beta (IL-12RB), also known as a beta subunit of IL-20 receptor (IL-20RB), belongs to the type II cytokine receptor family. IL-20R beta is widely expressed with highest levels in skin and testis and highly expressed in psoriatic skin^[1].
IL-20R beta forms functional heterodimers with different subunit protein. IL-20R beta serves as the receptor for IL-19, IL-20 and IL-24 by dimerizing with IL20RA, however serves as the receptor for IL-20 and IL-24 by dimerizing with IL-22RA1^[2].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1, act function by binding IL-20, and then stimulates a signal transduction pathway through STAT3 in a keratinocyte cell line^[1].
However, the expression of both IL-20RB/IL-20RA is found to be upregulated in psoriatic skin lesions on keratinocytes^[3].
IL-20RB/IL-20RA and IL-20RB/IL-22RA1 bind to IL-24, induce rapid activation of Stat-1 and Stat-3 transcription factors, which appear to play a role in cell survival and proliferation^[4].
The sequence of amino acids in IL-12 beta proteins of mouse is very different from human (64.64%).

IL-2R beta^-/- CD8 and CD4 T cells isolated from IL-2R beta-chain-deficient mice is more sensitive to Con A or anti-CD3/CD28 stimulation, results in IFN-γ⁺ and IL-2 secretion increase in CD8 and CD4 T cells and IL-1 secretion decrease in IL-2R beta^-/- CD4 cells^[5].

IL-2R beta-chain (IL-2R2) deficient in mice results significantly more Ag-specific CD8 IFN-gamma+ and CD4 IFN-gamma+ T cells developed to locally applied DNA vaccines^[5].

Measured by its binding ability in a functional ELISA.

Mouse

HEK293

C-His

E9Q9A6/NP_001028715 (V27-S225)

213208  [NCBI]

Partial

VSVLPAPQNLSVQSTNMKHLLMWNPVTQPGETVLYCVEYQGEYESLYMSHIWIPSSQCSPTKSLECDVTDDITATVPYNFRVKAMLGSQTSAWSNLEHPFNRNATVLTPPRMEVTEHGLHLVIELEDLGPQFEFLVVYWRREPGAAEHVKMVRSGDIPVHLETMEPGAMYCVKAQALVKAIGRHSAFSQPTCVEMQGES

Approximately 23.8 kDa.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.

• [1]. Blumberg H, et al. Interleukin 20: discovery, receptor identification, and role in epidermal function. Cell. 2001 Jan 12;10 4(1):9-19.  [Content Brief]

  [2]. Wegenka UM. IL-20: biological functions mediated through two types of receptor complexes. Cytokine Growth Factor Rev. 2010 Oct;21(5):353-63.  [Content Brief]

  [3]. Sheikh F, et al. Cutting edge: IL-26 signals through a novel receptor complex composed of IL-20 receptor 1 and IL-10 receptor 2. J Immunol. 2004 Feb 15;172(4):2006-10.  [Content Brief]

  [4]. Wang M, et al. Interleukin-24 and its receptors. Immunology. 2005 Feb;114(2):166-70.  [Content Brief]

  [5]. Wahl C, et al. IL-20 receptor 2 signaling down-regulates antigen-specific T cell responses. J Immunol. 2009 Jan 15;182(2):802-10.  [Content Brief]