IL-21 Protein, Mouse (HEK293, His)

IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG(1) and IgG(3) by B cells, thereby forming a humoral immune response. IL-21 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-21 protein, expressed by HEK293, with C-His labeled tag.

IL-21, a cytokine endowed with immunoregulatory prowess, emerges as a key player in orchestrating the delicate transition between innate and adaptive immunity. This multifaceted regulator takes the stage in inducing the production of IgG(1) and IgG(3) in B-cells, thereby substantiating its pivotal role in shaping humoral immune responses. IL-21 finds its niche in fostering the generation and perpetuation of T follicular helper (Tfh) cells and the intricate formation of germinal centers. Collaborating synergistically with IL6, it exercises command over the early development of Tfh cells, contributing indispensably to a robust antibody response during acute viral infections. Beyond B-cells, IL-21 extends its influence to the realm of natural killer (NK) cells, where, in synergy with IL15, it fuels their proliferation and maturation. Further, IL-21 flexes its regulatory muscle, guiding the proliferation and maturation of mature B- and T-cells in response to activating stimuli. In tandem with IL15 and IL18, it orchestrates the production of interferon-gamma in both T-cells and NK cells. Notably, during T-cell-mediated immune responses, IL-21 steps in as a potential inhibitor, dampening the activation and maturation of dendritic cells, unveiling a nuanced regulatory role in immune dynamics.

Measured by its binding ability in a functional ELISA. Immobilized Mouse IL-21 Protein, His Tag at 5 μg/mL (100 μL/well) can bind Biotinylated Mouse IL-21 R Protein, His, Avitag.

Mouse

HEK293

C-His

Q9ES17 (P25-S146)

60505

Partial

PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

Approximately 20 kDa and 23-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with 10% trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.