1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-22
  5. IL-22 Protein, Canine (HEK293, His)

IL-22 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-22 protein, expressed by HEK293, with C-8*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-22 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-22 protein, expressed by HEK293, with C-8*His tag.

Background

IL-22 Protein belongs to the IL-10 family and is recognized for its significant divergence from other family members. This protein functions as a vital cytokine involved in numerous immune responses and inflammatory processes. IL-22 plays a crucial role in promoting the activation and recruitment of immune cells, including T-helper 2 (Th2) cells, mast cells, and eosinophils, to sites of inflammation. It is primarily secreted by epithelial and endothelial cells and exerts its effects through the IL-22 receptor. Upon binding, IL-22 stimulates the production of various pro-inflammatory cytokines and chemokines. Notably, IL-22 has been implicated in a wide range of diseases, such as asthma, allergic diseases, and autoimmune disorders, underscoring its significance as a potential therapeutic target for modulating immune responses.

Biological Activity

Immobilized Canine IL-22, His Tag at 5 μg/ml(100 μl/well) on the plate. Dose response curve for Human IL-22R alpha 1, hFc Tag with the EC50 of 43.5 ng/ml determined by ELISA.

Species

Canine

Source

HEK293

Tag

C-8*His

Accession

E2R2K7 (L34-V179)

Gene ID

481153

Molecular Construction
N-term
IL-22 (L34-V179)
Accession # E2R2K7
8*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-22; IL-22; IL-TIF; IL-TIF alpha; IL-22a
AA Sequence

LPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVNMGERCYLMKEVLNFTLEEVLLPQSDRFQPYMQEVVPFLARLSNKLSQCHIENDDQHIQRNVQKLKDTVQKLGENGEIKAIGELDLLFMALRNACV

Predicted Molecular Mass
18.4 kDa
Molecular Weight

Approximately 32-42 kDa,based on Bis-Tris PAGE under reducing conditions, due to the glycosylation.

Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.001 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-22 Protein, Canine (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-22 Protein, Canine (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-22 Protein, Canine (HEK293, His)
Cat. No.:
HY-P704130
Quantity:
MCE Japan Authorized Agent: