IL-22 Protein, Canine (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-22 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-22 protein, expressed by HEK293, with C-8*His tag.

For research use only. We do not sell to patients.
  • Species: Canine
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IL-22 Protein, Canine (HEK293, His) is the recombinant canine-derived IL-22 protein, expressed by HEK293, with C-8*His tag.

Background

IL-22 Protein belongs to the IL-10 family and is recognized for its significant divergence from other family members. This protein functions as a vital cytokine involved in numerous immune responses and inflammatory processes. IL-22 plays a crucial role in promoting the activation and recruitment of immune cells, including T-helper 2 (Th2) cells, mast cells, and eosinophils, to sites of inflammation. It is primarily secreted by epithelial and endothelial cells and exerts its effects through the IL-22 receptor. Upon binding, IL-22 stimulates the production of various pro-inflammatory cytokines and chemokines. Notably, IL-22 has been implicated in a wide range of diseases, such as asthma, allergic diseases, and autoimmune disorders, underscoring its significance as a potential therapeutic target for modulating immune responses.

Verified Bioactivity

Immobilized Canine IL-22, His Tag at 5 μg/ml(100 μl/well) on the plate. Dose response curve for Human IL-22R alpha 1, hFc Tag with the EC50 of 43.5 ng/ml determined by ELISA.

Technical Parameters

  • Species Canine
  • Source HEK293
  • Tag C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • IL-22 (L34-V179)
      Accession # E2R2K7
    • 8*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    IL22; TIFa; Interleukin 22; IL-10-Related T-Cell-Derived Inducible Factor; IL-TIF; Cytokine Zcyto18; ILTIF; Interleukin-22; IL-22; MGC79382; TIFIL-23; MGC79384; Zcyto18; IL-10-Related T-Cell-Derived-Inducible Factor; IL-D110; Interferon 2B1; IL-21; ZCYTO1

  • AA Sequence

    LPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVNMGERCYLMKEVLNFTLEEVLLPQSDRFQPYMQEVVPFLARLSNKLSQCHIENDDQHIQRNVQKLKDTVQKLGENGEIKAIGELDLLFMALRNACV

  • Predicted Molecular Mass

    18.4 kDa

  • Molecular Weight

    Approximately 32-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<0.001 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00