1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Receptor Proteins Biotinylated Proteins
  3. Interleukin & Receptors NK Cell CD Proteins Cytokine Receptors
  4. IL-2 Receptor
  5. IL-2R gamma/Common gamma-Chain/CD132
  6. IL-2R gamma/CD132 Protein, Human (Biotinylated, HEK293, His-Avi)

IL-2R gamma/CD132 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78083
Handling Instructions Technical Support

IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types. IL-2R gamma/CD132 Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant human extracellular region of IL-2R gamma (L23-N254) with a C-Terminal Avi and a His tag, which is produced in HEK293 cells.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2[1]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[2]. IL-2R gamma/CD132 Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant human extracellular region of IL-2R gamma (L23-N254) with a C-Terminal Avi and a His tag, which is produced in HEK293 cells.

Background

IL-2R gamma (CD132), a receptor for IL-2, is a member of the type I cytokine receptor family and type 5 subfamily. IL-2R gamma is expressed in leucocyte subsets and human monocytes[1][3]. Human IL-2R gamma consists of extracellular domain (L23-A262), helical domain (V263-L283), and cytoplasmic domain (E284-T369).
The sequence of amino acids in IL-2R beta differs in different species. Human IL-2R gamma shares <75% aa sequence identity with mouse and rats.
IL-2R gamma has low-affinity for IL-2, but has intermediate affinity for IL-2 when forming heterodimer with IL-2R beta. IL-2R beta/gama heterodimer complex transduces a signal when IL-2 concentrations are relatively high[1]. IL-2R gamma can be utilized by the IL-2, IL-4, IL-7, IL-9, and IL-15 receptor, and takes part in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[2]. IL-2R gamma is tightly up-regulated by IL-2 and IFN gamma[3]. Mutations of L-2R gamm cause human X-linked severe combined immunodeficiency (XSCID)[4].
IL-2R gamma is involved in inflammatory response, and mediates activation of the cells[1].

In Vitro

IL-2R gamma (human) migrates with a molecular weight corresponding to 55–60 kDa (immunoblotting of lysates prepared from Sf9 cells infected with VL1392-hIL-2Rγ)[5].
IL-2R gamma binds to IL-2 in recombinant IL-2R gamma plasmid (pGEX-4T-1-IL-2Rγ)-transfected 293T cells[6].

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

P31785-1 (L23-N254)

Gene ID
Molecular Construction
N-term
IL-2R gamma/CD132 (L23-N254)
Accession # P31785-1
8*His-Avi
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
CD132; CIDX; IL-2 R gamma; IL2RG; IMD4; P64; SCIDX; SCIDX1; gammaC
AA Sequence

LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN

Predicted Molecular Mass
39.9 kDa
Molecular Weight

Approximately 58-70 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IL-2R gamma/CD132 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-2R gamma/CD132 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78083
Quantity:
MCE Japan Authorized Agent: