IL-2R gamma/CD132 Protein, Human (Biotinylated, HEK293, His-Avi)
IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types. IL-2R gamma/CD132 Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant human extracellular region of IL-2R gamma (L23-N254) with a C-Terminal Avi and a His tag, which is produced in HEK293 cells.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2[1]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[2]. IL-2R gamma/CD132 Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant human extracellular region of IL-2R gamma (L23-N254) with a C-Terminal Avi and a His tag, which is produced in HEK293 cells.
Background
IL-2R gamma (CD132), a receptor for IL-2, is a member of the type I cytokine receptor family and type 5 subfamily. IL-2R gamma is expressed in leucocyte subsets and human monocytes[1][3]. Human IL-2R gamma consists of extracellular domain (L23-A262), helical domain (V263-L283), and cytoplasmic domain (E284-T369).
The sequence of amino acids in IL-2R beta differs in different species. Human IL-2R gamma shares <75% aa sequence identity with mouse and rats.
IL-2R gamma has low-affinity for IL-2, but has intermediate affinity for IL-2 when forming heterodimer with IL-2R beta. IL-2R beta/gama heterodimer complex transduces a signal when IL-2 concentrations are relatively high[1]. IL-2R gamma can be utilized by the IL-2, IL-4, IL-7, IL-9, and IL-15 receptor, and takes part in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[2]. IL-2R gamma is tightly up-regulated by IL-2 and IFN gamma[3]. Mutations of L-2R gamm cause human X-linked severe combined immunodeficiency (XSCID)[4].
IL-2R gamma is involved in inflammatory response, and mediates activation of the cells[1].
In Vitro
IL-2R gamma (human) migrates with a molecular weight corresponding to 55–60 kDa (immunoblotting of lysates prepared from Sf9 cells infected with VL1392-hIL-2Rγ)[5].
IL-2R gamma binds to IL-2 in recombinant IL-2R gamma plasmid (pGEX-4T-1-IL-2Rγ)-transfected 293T cells[6].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P31785-1 (L23-N254)
-
Molecular Construction
-
N-term
-
IL-2R gamma/CD132 (L23-N254)
Accession # P31785-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
IL2RG; IL-2 Receptor Subunit Gamma; Prev. SCIDX1; CD132 Antigen; Prev. CIDX; IL-2RG; Prev. IMD4; Common Cytokine Receptor Gamma Chain; Cytokine Receptor Common Subunit Gamma; Combined Immunodeficiency, X-Linked; GammaC; Severe Combined Immunodeficiency; C
-
AA Sequence
LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
-
Predicted Molecular Mass
39.9 kDa
-
Molecular Weight
Approximately 58-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
[1]. S Hodge, et al. Surface and intracellular interleukin-2 receptor expression on various resting and activated populations involved in cell-mediated immunity in human peripheral blood. Scand J Immunol. 2000 Jan;51(1):67-75. [Content Brief]
[2]. W P Weidanz, et al. Signalling through the IL-2 receptor γ(c) peptide (CD135) is essential for the expression of immunity to Plasmodium chabaudi adami blood-stage malaria. [Content Brief]
[3]. M C Bosco, et al. The gamma subunit of the interleukin-2 receptor is expressed in human monocytes and modulated by interleukin-2, interferon gamma, and transforming growth factor beta 1. Blood. 1994 Jun 15;83(12):3462-10. [Content Brief]
[4]. K Sugamura, et al. The interleukin-2 receptor gamma chain: its role in the multiple cytokine receptor complexes and T cell development in XSCID. Annu Rev Immunol. 1996;14:179-208. [Content Brief]
[5]. K Stenroos, et al. Expression of the mouse interleukin-2 receptor gamma chain in insect cells using a baculovirus expression vector--comparison with the human common gamma chain. Scand J Immunol. 1997 Feb;45(2):140-7. [Content Brief]
[6]. Mengmeng Zhao, et al. Expression of Interleukin-2 receptor subunit gamma (IL-2Rγ) and its binding with IL-2 induced activation of CD4 T lymphocytes in flounder (Paralichthys olivaceus). Fish Shellfish Immunol. 2022 Mar;122:426-439. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)