IL-33 Protein, Cynomolgus (HEK293, His)
Based on 1 Customer Validation
The IL-33 protein is part of the IL-1 family, a different cytokine that is critical in immune responses and inflammation. IL-33 acts through its receptor ST2 to promote the activation and recruitment of immune cells such as Th2 cells, mast cells, and eosinophils to sites of inflammation. IL-33 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-33 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The IL-33 protein is part of the IL-1 family, a different cytokine that is critical in immune responses and inflammation. IL-33 acts through its receptor ST2 to promote the activation and recruitment of immune cells such as Th2 cells, mast cells, and eosinophils to sites of inflammation. IL-33 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-33 protein, expressed by HEK293 , with N-His labeled tag.
Background
IL-33 protein belongs to the IL-1 family and is known for its high divergence from other family members. It functions as an important cytokine involved in various immune responses and inflammatory processes. IL-33 plays a crucial role in promoting the activation and recruitment of immune cells, such as T-helper 2 (Th2) cells, mast cells, and eosinophils, to sites of inflammation. It is primarily produced by epithelial and endothelial cells and acts through its receptor, ST2, to induce the production of other pro-inflammatory cytokines and chemokines. IL-33 has been implicated in various diseases, including asthma, allergic diseases, and autoimmune disorders, highlighting its significance as a therapeutic target for modulating immune responses.
Verified Bioactivity
Immobilized Cynomolgus IL-33, His Tag at 0.5μg/ml (100μl/well) on the plate. Dose response curve for Anti-IL-33 Antibody, hFc Tag with the EC50 of 2.4ng/ml determined by ELISA.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-8*His
-
Accession
A0A2K5W3I1 (H109-I270)
-
Molecular Construction
-
N-term
-
8*His
-
IL-33 (H109-I270)
Accession # A0A2K5W3I1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IL33; DVS27-Related Protein; Prev. C9orf26; Chromosome 9 Open Reading Frame 26 (NF-HEV); NF-HEV; Interleukin-1 Family, Member 11; IL1F11; Alternative Protein IL33; Interleukin-33; IL-1F11; DVS27; NFEHEV; Nuclear Factor From High Endothelial Venules; IL-33
-
AA Sequence
HDSSITGISPITESLASLSTYNDQSITFALEDESYEIYVEDLKKDKKKDKVLLSYYESQHPSSESGDGVDGKMLMVTLSPTKDFWLQANNKEHSVELHKCEKPLPDQAFFVLHNRSFNCVSFECKTDPGVFIGVKDNHLALIKVDYSENLGSENILFKLSEI
-
Predicted Molecular Mass
19.2 kDa
-
Molecular Weight
Approximately 25-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
