1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Interleukin & Receptors
  4. IL-5
  5. IL-5 Protein, Mouse (Biotinylated, HEK293, His-Avi)

IL-5 Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78155
Instrucciones de manejo Technical Support

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
20 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

IL-5 protein is expressed by T lymphocytes and NK cells and regulates eosinophils, affecting their survival, differentiation and chemotaxis.In addition, IL-5 stimulates immunoglobulin production, growth, and differentiation of activated and resting B cells.IL-5 Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived IL-5 protein, expressed by HEK293 , with N-His, N-Avi labeled tag.

Background

IL-5 Protein, a homodimeric cytokine predominantly expressed by T-lymphocytes and NK cells, plays a pivotal role in the regulation of eosinophils by influencing their survival, differentiation, and chemotaxis. Additionally, IL-5 acts on both activated and resting B-cells, stimulating immunoglobulin production, growth, and differentiation. Mechanistically, the biological effects of IL-5 are mediated through a receptor complex composed of the IL5RA subunit and the cytokine receptor common subunit beta/CSF2RB. Upon binding to the receptor, IL-5 triggers the activation of various kinases, including LYN, SYK, and JAK2, thus propagating signals through the RAS-MAPK and JAK-STAT5 pathways (By similarity). Structurally, IL-5 forms a homodimer that is disulfide-linked and interacts with its receptor components IL5RA and CSF2RB, highlighting the specificity and complexity of its molecular interactions in orchestrating immune responses.

Actividad biológica

Mouse IL-5 R alpha, His Tag immobilized on CM5 Chip can bind Biotinylated Mouse IL-5, His Avi Tag with an affinity constant of 0.511 μM as determined in SPR assay (Biacore T200).

Species

Mouse

Source

HEK293

Tag

N-Avi;N-8*His

Accession

P04401 (M21-G133)

Gene ID
Molecular Construction
N-term
8*His-Avi
IL-5 (M21-G133)
Accession # P04401
C-term
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
Interleukin-5; IL-5; T-cell replacing factor; TRF; EDF
AA Sequence

MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG

Predicted Molecular Mass
16 kDa
Peso molecular

Approximately 16 kDa & 20-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureza

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 7.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Envío

Shipping with dry ice.

Documentación

IL-5 Protein, Mouse (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

IL-5 Protein, Mouse (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
IL-5 Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78155
Cantidad:
MCE Japan Authorized Agent: