IL28RA/IFNLR1 Protein, Human (HEK293, His)
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q8IU57-1 (R21-A228)
-
Gene ID163702
-
Molecular Construction
-
N-term
-
IL28RA (R21-A228)
Accession # Q8IU57-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
IFNLR1; IFN-Lambda Receptor 1; Prev. IL28RA; IL-28R-Alpha; CRF2/12; CRF2-12; IL-28R1; IL-28RA; IFNLR; LICR2; Interleukin 28 Receptor, Alpha (Interferon, Lambda Receptor); Class II Cytokine Receptor CRF2/12; Likely Interleukin Or Cytokine Receptor 2; Inter
-
AA Sequence
RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA
-
Predicted Molecular Mass
25.5 kDa
-
Molecular Weight
Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
