1. Recombinant Proteins
  2. Enzymes & Regulators
  3. INCENP Protein, Human (sf9, His)

INCENP Protein, Human (sf9, His) is the recombinant human-derived INCENP, expressed by Sf9 insect cells , with His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
20 μg Get quote
100 μg Get quote

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

INCENP Protein, Human (sf9, His) is the recombinant human-derived INCENP, expressed by Sf9 insect cells , with His labeled tag. ,

Background

AURB-INCENP is a component of the chromosomal passenger complex (CPC), which acts as a key regulator of mitosis. The CPC complex plays essential roles at the centromere to ensure proper chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. AURB-INCENP serves as a scaffold regulating CPC localization and activity: its C-terminus associates with AURKB or AURKC, the N-terminus binds BIRC5/survivin and CDCA8/borealin to tether the CPC to the inner centromere, while the microtubule-binding activity within the central SAH domain directs AURKB/C toward substrates near microtubules. The flexibility of the SAH domain is proposed to enable AURKB/C to track substrates on dynamic microtubules while maintaining CPC docking to static chromatin (by similarity). Additionally, AURB-INCENP activates AURKB and AURKC, regulates the localization of CBX5 to mitotic centromeres, and controls the kinetochore localization of BUB1.

Species

Human

Source

Sf9 insect cells

Tag

His

Accession

Q9NQS7-1 (A783-H918)

Gene ID

3619

Protein Length

Partial

Synonyms
Inner centromere protein; INCENP
AA Sequence

AAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSSLAYSLKKH

Predicted Molecular Mass
19 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Documentation

INCENP Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

INCENP Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
INCENP Protein, Human (sf9, His)
Cat. No.:
HY-P702967
Quantity:
MCE Japan Authorized Agent: