INCENP Protein, Human (sf9, His)

INCENP Protein, Human (sf9, His) is the recombinant human-derived INCENP, expressed by Sf9 insect cells , with His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

INCENP Protein, Human (sf9, His) is the recombinant human-derived INCENP, expressed by Sf9 insect cells , with His labeled tag. ,

Background

AURB-INCENP is a component of the chromosomal passenger complex (CPC), which acts as a key regulator of mitosis. The CPC complex plays essential roles at the centromere to ensure proper chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. AURB-INCENP serves as a scaffold regulating CPC localization and activity: its C-terminus associates with AURKB or AURKC, the N-terminus binds BIRC5/survivin and CDCA8/borealin to tether the CPC to the inner centromere, while the microtubule-binding activity within the central SAH domain directs AURKB/C toward substrates near microtubules. The flexibility of the SAH domain is proposed to enable AURKB/C to track substrates on dynamic microtubules while maintaining CPC docking to static chromatin (by similarity). Additionally, AURB-INCENP activates AURKB and AURKC, regulates the localization of CBX5 to mitotic centromeres, and controls the kinetochore localization of BUB1.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    INCENP; Binds And Activates Aurora-B And -C In Vivo And In Vitro; Inner Centromere Protein; Inner Centromere Protein Antigens (135kD, 155kD); Inner Centromere Protein Antigens 135/155kDa; Inner Centromere Protein INCENP; FLJ31633; Chromosomal Passenger Pr

  • AA Sequence

    AAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSSLAYSLKKH

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00