INCENP Protein, Human (sf9, His)

INCENP Protein, Human (sf9, His) is the recombinant human-derived INCENP, expressed by Sf9 insect cells , with His labeled tag. ,

AURB-INCENP is a component of the chromosomal passenger complex (CPC), which acts as a key regulator of mitosis. The CPC complex plays essential roles at the centromere to ensure proper chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. AURB-INCENP serves as a scaffold regulating CPC localization and activity: its C-terminus associates with AURKB or AURKC, the N-terminus binds BIRC5/survivin and CDCA8/borealin to tether the CPC to the inner centromere, while the microtubule-binding activity within the central SAH domain directs AURKB/C toward substrates near microtubules. The flexibility of the SAH domain is proposed to enable AURKB/C to track substrates on dynamic microtubules while maintaining CPC docking to static chromatin (by similarity). Additionally, AURB-INCENP activates AURKB and AURKC, regulates the localization of CBX5 to mitotic centromeres, and controls the kinetochore localization of BUB1.

Human

Sf9 insect cells

His

Q9NQS7-1 (A783-H918)

3619

Partial

AAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSSLAYSLKKH

≥ 90%, as determined by reducing SDS-PAGE.