Insulin Protein, Bovine

Insulin Protein regulates glucose metabolism in the body. It binds to insulin receptors, activating signaling pathways that facilitate glucose uptake and storage. Insulin Protein also regulates lipid metabolism and protein synthesis. Understanding its functions is crucial for developing treatments for diabetes and metabolic disorders. Insulin Protein, Bovine is a recombinant protein dimer complex containing bovine-derived Insulin protein, expressed by P. pastoris, with tag free. Insulin Protein, Bovine, has molecular weight of ~6 kDa.

Insulin, a pivotal hormone in glucose homeostasis, plays a crucial role in reducing blood glucose concentration. Its actions extend beyond glycemic control, as it enhances cell permeability to monosaccharides, amino acids, and fatty acids. Furthermore, insulin facilitates metabolic processes such as glycolysis, the pentose phosphate cycle, and glycogen synthesis in the liver, contributing to overall energy regulation. Structurally, insulin is composed of a heterodimeric arrangement, consisting of a B chain and an A chain connected by two disulfide bonds. The multifaceted functions of insulin underscore its significance in orchestrating metabolic responses and maintaining physiological balance.

Bovine

P. pastoris

Tag Free

P01317 (F25-A54&G85-N105)

/

AFVNQHLCGSHLVEALYLVCGERGFFYTPKA&GIVEQCCASVCSLYQLENYCN

Approximately 6 kDa

Greater than 95% as determined by reducing SDS-PAGE.

< 0.1 EU/μg of protein by gel clotting method