Copy Link Print Information

Insulin Protein, Bovine (P. pastoris)

3 Cited Publications
Customer Review

Based on 3 publication(s) in Google Scholar

Insulin Protein regulates glucose metabolism in the body. It binds to insulin receptors, activating signaling pathways that facilitate glucose uptake and storage. Insulin Protein also regulates lipid metabolism and protein synthesis. Understanding its functions is crucial for developing treatments for diabetes and metabolic disorders. Insulin Protein, Bovine (P. pastoris) is the recombinant bovine-derived Insulin protein, expressed by P. pastoris, with tag free.

For research use only. We do not sell to patients.
  • Species: Bovine
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Insulin Protein, Bovine (P. pastoris) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Insulin Protein regulates glucose metabolism in the body. It binds to insulin receptors, activating signaling pathways that facilitate glucose uptake and storage. Insulin Protein also regulates lipid metabolism and protein synthesis. Understanding its functions is crucial for developing treatments for diabetes and metabolic disorders. Insulin Protein, Bovine (P. pastoris) is the recombinant bovine-derived Insulin protein, expressed by P. pastoris, with tag free.

Background

Insulin, a pivotal hormone in glucose homeostasis, plays a crucial role in reducing blood glucose concentration. Its actions extend beyond glycemic control, as it enhances cell permeability to monosaccharides, amino acids, and fatty acids. Furthermore, insulin facilitates metabolic processes such as glycolysis, the pentose phosphate cycle, and glycogen synthesis in the liver, contributing to overall energy regulation. Structurally, insulin is composed of a heterodimeric arrangement, consisting of a B chain and an A chain connected by two disulfide bonds. The multifaceted functions of insulin underscore its significance in orchestrating metabolic responses and maintaining physiological balance.

Verified Bioactivity

Measure by its ability by a dose-response proliferation assay using human MCF7 epithelial cells. The ED50 for this effect is <1.0 μg/mL. The specific activity of this protein is > 1.0 × 103 IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)

Technical Parameters

  • Species Bovine
  • Source P. pastoris
  • Tag Tag Free
  • Accession

    P01317 (F25-A54&G85-N105)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • Insulin (F25-A54&G85-N105)
      Accession # P01317
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    INS; Proinsulin; Prev. IDDM1; PNDM4; Prev. IDDM2; IDDM; Insulin-Dependent Diabetes Mellitus 2; ILPR; Preproinsulin; IRDN; Insulin; MODY10

  • AA Sequence

    AFVNQHLCGSHLVEALYLVCGERGFFYTPKA&GIVEQCCASVCSLYQLENYCN

  • Molecular Weight

    Approximately 6 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Citric acid, pH 2.0-3.0.

Endotoxin Level

< 0.1 EU/μg of protein by gel clotting method

Reconstitution

It is not recommended to reconstitute to a concentration less than 1 mg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Insulin Protein, Bovine (P. pastoris) Product Image
    1/16
  • Insulin Protein, Bovine (P. pastoris) Product Image