IRF1 Protein, Human (His, Strep)

Customer Review

Based on 1 Customer Validation

IRF1 Protein, Human (His, Strep) is the recombinant human-derived IRF1, expressed by E. coli , with Strep, His labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

IRF1 Protein, Human (His, Strep) is the recombinant human-derived IRF1, expressed by E. coli , with Strep, His labeled tag. ,

Background

IRF 1 is a transcription regulator with remarkable functional diversity, involved in modulating cellular responses such as transcription of IFN and IFN-inducible genes, host defense against viral/bacterial infections, hematopoiesis, inflammation, immune responses, cell proliferation/differentiation, cell cycle regulation, and growth arrest/apoptosis following DNA damage. It activates or represses target genes by binding to interferon-stimulated response elements (ISREs) in their promoters, stimulating both innate and adaptive immunity. IRF 1 plays an essential role in IFNG-dependent immunity against mycobacteria and competes with the repressor ZBED2 for promoter binding. Its transcriptional targets include antiviral (e.g., IFN-alpha/beta, RIGI), antibacterial (e.g., GBP2, GBP5), antiproliferative (e.g., p53/TP53, CDKN1A), pro-apoptotic (e.g., BBC3/PUMA, CASP1), immune-related (e.g., IL7, IL12A/B), DNA repair (e.g., POLQ/POLH), MHC expression (e.g., TAP1, CIITA), and metabolic (e.g., ACOD1/IRG1) genes, while suppressing antiproliferation (e.g., BIRC5/survivin, CCNB1) and immune-suppressive (e.g., FOXP3, IL4) genes. It enhances p53/TP53 acetylation via EP300 recruitment and directly impacts NK cell maturation, macrophage IL12 production, Th1 development, and CD8+ T-cell maturation, while inhibiting Treg differentiation and promoting dendritic cell maturation. Additionally, it acts as a tumor suppressor by antagonizing tumor growth and stimulating antitumor immunity.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;N-StrepⅡ
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    IRF1; Interferon Regulatory Factor 1 Isoform I4; Interferon Regulatory Factor 1; Interferon Regulatory Factor-1; IRF-1; Interferon Regulatory Factor; MAR; IMD117

  • AA Sequence

    MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLP

  • Predicted Molecular Mass

    16.5 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00