1. Recombinant Proteins
  2. Others
  3. IRF1 Protein, Human (His, Strep)

IRF1 Protein, Human (His, Strep) is the recombinant human-derived IRF1, expressed by E. coli , with Strep, His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IRF1 Protein, Human (His, Strep) is the recombinant human-derived IRF1, expressed by E. coli , with Strep, His labeled tag. ,

Background

IRF 1 is a transcription regulator with remarkable functional diversity, involved in modulating cellular responses such as transcription of IFN and IFN-inducible genes, host defense against viral/bacterial infections, hematopoiesis, inflammation, immune responses, cell proliferation/differentiation, cell cycle regulation, and growth arrest/apoptosis following DNA damage. It activates or represses target genes by binding to interferon-stimulated response elements (ISREs) in their promoters, stimulating both innate and adaptive immunity. IRF 1 plays an essential role in IFNG-dependent immunity against mycobacteria and competes with the repressor ZBED2 for promoter binding. Its transcriptional targets include antiviral (e.g., IFN-alpha/beta, RIGI), antibacterial (e.g., GBP2, GBP5), antiproliferative (e.g., p53/TP53, CDKN1A), pro-apoptotic (e.g., BBC3/PUMA, CASP1), immune-related (e.g., IL7, IL12A/B), DNA repair (e.g., POLQ/POLH), MHC expression (e.g., TAP1, CIITA), and metabolic (e.g., ACOD1/IRG1) genes, while suppressing antiproliferation (e.g., BIRC5/survivin, CCNB1) and immune-suppressive (e.g., FOXP3, IL4) genes. It enhances p53/TP53 acetylation via EP300 recruitment and directly impacts NK cell maturation, macrophage IL12 production, Th1 development, and CD8+ T-cell maturation, while inhibiting Treg differentiation and promoting dendritic cell maturation. Additionally, it acts as a tumor suppressor by antagonizing tumor growth and stimulating antitumor immunity.

Species

Human

Source

E. coli

Tag

N-His;N-StrepⅡ

Accession

P10914 (M1-P113)

Gene ID

3659

Protein Length

Partial

Synonyms
Interferon regulatory factor 1; IRF1; Homo sapiens; Human; IRF-1; Activator; DNA-binding; Repressor
AA Sequence

MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLP

Molecular Weight

Approximately 16.5 kDa

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES , pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

IRF1 Protein, Human (His, Strep) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IRF1 Protein, Human (His, Strep)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IRF1 Protein, Human (His, Strep)
Cat. No.:
HY-P703152
Quantity:
MCE Japan Authorized Agent: