IRF1 Protein, Human (His, Strep)
Based on 1 Customer Validation
IRF1 Protein, Human (His, Strep) is the recombinant human-derived IRF1, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
IRF1 Protein, Human (His, Strep) is the recombinant human-derived IRF1, expressed by E. coli , with Strep, His labeled tag. ,
Background
IRF 1 is a transcription regulator with remarkable functional diversity, involved in modulating cellular responses such as transcription of IFN and IFN-inducible genes, host defense against viral/bacterial infections, hematopoiesis, inflammation, immune responses, cell proliferation/differentiation, cell cycle regulation, and growth arrest/apoptosis following DNA damage. It activates or represses target genes by binding to interferon-stimulated response elements (ISREs) in their promoters, stimulating both innate and adaptive immunity. IRF 1 plays an essential role in IFNG-dependent immunity against mycobacteria and competes with the repressor ZBED2 for promoter binding. Its transcriptional targets include antiviral (e.g., IFN-alpha/beta, RIGI), antibacterial (e.g., GBP2, GBP5), antiproliferative (e.g., p53/TP53, CDKN1A), pro-apoptotic (e.g., BBC3/PUMA, CASP1), immune-related (e.g., IL7, IL12A/B), DNA repair (e.g., POLQ/POLH), MHC expression (e.g., TAP1, CIITA), and metabolic (e.g., ACOD1/IRG1) genes, while suppressing antiproliferation (e.g., BIRC5/survivin, CCNB1) and immune-suppressive (e.g., FOXP3, IL4) genes. It enhances p53/TP53 acetylation via EP300 recruitment and directly impacts NK cell maturation, macrophage IL12 production, Th1 development, and CD8+ T-cell maturation, while inhibiting Treg differentiation and promoting dendritic cell maturation. Additionally, it acts as a tumor suppressor by antagonizing tumor growth and stimulating antitumor immunity.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-StrepⅡ
-
Accession
P10914 (M1-P113)
-
Gene ID3659
-
Protein Length
Partial
-
Synonyms
IRF1; Interferon Regulatory Factor 1 Isoform I4; Interferon Regulatory Factor 1; Interferon Regulatory Factor-1; IRF-1; Interferon Regulatory Factor; MAR; IMD117
-
AA Sequence
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLP
-
Predicted Molecular Mass
16.5 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)