1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Immunoglobulin-like Cell Adhesion Molecules
  5. Junctional Adhesion Molecule-Like Protein (JAML)
  6. JAML/AMICA Protein, Mouse (HEK293, His)

JAML/AMICA protein is a transmembrane protein on leukocytes that regulates migration and activation by interacting with CXADR on adjacent epithelial/endothelial cells. It is essential for the activation of γ-δ T cells in the epithelium, signaling through PI3 kinase and MAP kinase to promote T cell proliferation, cytokine/growth factor production, and tissue repair. JAML/AMICA Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAML/AMICA protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

JAML/AMICA protein is a transmembrane protein on leukocytes that regulates migration and activation by interacting with CXADR on adjacent epithelial/endothelial cells. It is essential for the activation of γ-δ T cells in the epithelium, signaling through PI3 kinase and MAP kinase to promote T cell proliferation, cytokine/growth factor production, and tissue repair. JAML/AMICA Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAML/AMICA protein, expressed by HEK293 , with C-His labeled tag.

Background

Junctional adhesion molecule-like (JAML), also known as AMICA, is a transmembrane protein located on the plasma membrane of leukocytes, governing their migration and activation by interacting with CXADR, a receptor present on adjacent epithelial and endothelial cells. This interaction plays a crucial role in activating gamma-delta T-cells, a T-cell subpopulation residing in epithelia, contributing to tissue homeostasis and repair. Upon binding to epithelial CXADR, JAML initiates downstream signaling in gamma-delta T-cells through PI3-kinase and MAP kinases, leading to T-cell proliferation and the production of cytokines and growth factors that stimulate tissue repair. JAML also regulates the transmigration of leukocytes within epithelial and endothelial tissues by engaging in adhesive interactions with epithelial and endothelial CXADR. In its homodimeric form, JAML is particularly active in mediating leukocyte-endothelial cell adhesion. Additionally, JAML interacts with integrin alpha-4/beta-1 (ITGA4 and ITGB1), suggesting a role in the regulation of leukocyte-endothelial cell adhesion by controlling JAML homodimerization.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q80UL9 (Q21-L281)

Gene ID
Molecular Construction
N-term
JAML (Q21-L281)
Accession # Q80UL9
His
C-term
Protein Length

Extracellular Domain

Synonyms
Junctional adhesion molecule-like; Dendritic cell-specific protein CREA7; mCrea7; Amica1; Gm638
AA Sequence

QGLPGLTVSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPKDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQDEFQRTISPTPPTDKGQQGILNGNQL

Predicted Molecular Mass
30.9 kDa
Molecular Weight

Approximately 47.7 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

JAML/AMICA Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
JAML/AMICA Protein, Mouse (HEK293, His)
Cat. No.:
HY-P76465
Quantity:
MCE Japan Authorized Agent: