JAML/AMICA Protein, Mouse (HEK293, His)
JAML/AMICA protein is a transmembrane protein on leukocytes that regulates migration and activation by interacting with CXADR on adjacent epithelial/endothelial cells. It is essential for the activation of γ-δ T cells in the epithelium, signaling through PI3 kinase and MAP kinase to promote T cell proliferation, cytokine/growth factor production, and tissue repair. JAML/AMICA Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAML/AMICA protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
JAML/AMICA protein is a transmembrane protein on leukocytes that regulates migration and activation by interacting with CXADR on adjacent epithelial/endothelial cells. It is essential for the activation of γ-δ T cells in the epithelium, signaling through PI3 kinase and MAP kinase to promote T cell proliferation, cytokine/growth factor production, and tissue repair. JAML/AMICA Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAML/AMICA protein, expressed by HEK293 , with C-His labeled tag.
Background
Junctional adhesion molecule-like (JAML), also known as AMICA, is a transmembrane protein located on the plasma membrane of leukocytes, governing their migration and activation by interacting with CXADR, a receptor present on adjacent epithelial and endothelial cells. This interaction plays a crucial role in activating gamma-delta T-cells, a T-cell subpopulation residing in epithelia, contributing to tissue homeostasis and repair. Upon binding to epithelial CXADR, JAML initiates downstream signaling in gamma-delta T-cells through PI3-kinase and MAP kinases, leading to T-cell proliferation and the production of cytokines and growth factors that stimulate tissue repair. JAML also regulates the transmigration of leukocytes within epithelial and endothelial tissues by engaging in adhesive interactions with epithelial and endothelial CXADR. In its homodimeric form, JAML is particularly active in mediating leukocyte-endothelial cell adhesion. Additionally, JAML interacts with integrin alpha-4/beta-1 (ITGA4 and ITGB1), suggesting a role in the regulation of leukocyte-endothelial cell adhesion by controlling JAML homodimerization.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q80UL9 (Q21-L281)
-
Molecular Construction
-
N-term
-
JAML (Q21-L281)
Accession # Q80UL9 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
JAML; Adhesion Molecule, Interacts With CXADR Antigen 1; Prev. AMICA1; Dendritic-Cell Specific Protein CREA7-4; Junctional Adhesion Molecule-Like; Dendritic Cell-Specific Protein CREA7-1; Gm638; Adhesion Molecule AMICA; AMICA; CREA7-1; Adhesion Molecule I
-
AA Sequence
QGLPGLTVSSPQLRVHVGESVLMGCVVQRTEEKHVDRVDWLFSKDKDDASEYVLFYYSNLSVPTGRFQNRSHLVGDTFHNDGSLLLQDVQKADEGIYTCEIRLKNESMVMKKPVELWVLPEEPKDLRVRVGDTTQMRCSIQSTEEKRVTKVNWMFSSGSHTEEETVLSYDSNMRSGKFQSLGRFRNRVDLTGDISRNDGSIKLQTVKESDQGIYTCSIYVGKLESRKTIVLHVVQDEFQRTISPTPPTDKGQQGILNGNQL
-
Predicted Molecular Mass
30.9 kDa
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)