Copy Link Print Information

KIR2DS1 Protein, Human (P.pastoris, His)

Customer Review

Based on 1 Customer Validation

KIR2DS1, on NK cells, acts as a receptor for specific HLA-C alleles, like w6, without inhibiting NK cell activity. Interacting with the adapter protein TYROBP/DAP12, their collaboration enhances KIR2DS1 stability at the cell surface. This dynamic interplay highlights the intricate regulatory mechanisms associated with KIR2DS1, contributing to the modulation of NK cell responses. KIR2DS1 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS1 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • KIR2DS1 Protein, Human (P.pastoris, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

KIR2DS1, on NK cells, acts as a receptor for specific HLA-C alleles, like w6, without inhibiting NK cell activity. Interacting with the adapter protein TYROBP/DAP12, their collaboration enhances KIR2DS1 stability at the cell surface. This dynamic interplay highlights the intricate regulatory mechanisms associated with KIR2DS1, contributing to the modulation of NK cell responses. KIR2DS1 Protein, Human (P.pastoris, His) is the recombinant human-derived KIR2DS1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

KIR2DS1, situated on natural killer (NK) cells, functions as a receptor for specific HLA-C alleles, including w6, without exerting inhibitory effects on NK cell activity. This receptor engages with the adapter protein TYROBP/DAP12, and their interaction enhances the stability of KIR2DS1 at the cell surface. This intricate interplay underscores the dynamic regulatory mechanisms associated with KIR2DS1, contributing to the modulation of NK cell responses.

Technical Parameters

  • Species Human
  • Source P. pastoris
  • Tag N-6*His
  • Accession

    Q14954 (H22-H245, K91R)

  • Gene ID
    3806  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • KIR2DS1 (H22-H245, K91R)
      Accession # Q14954
    • C-term
  • Protein Length

    Extracellular Domain

  • Mutation

    K91R

  • Mutation Definition

    Natural variant

  • Synonyms

    KIR2DS1; Killer Cell Immunoglobulin-Like Receptor KIRDS1; Killer Cell Immunoglobulin Like Receptor, Two Ig Domains And Short Cytoplasmic Tail 1; Killer-Cell Immunoglobulin-Like Receptor; Killer Cell Immunoglobulin-Like Receptor 2DS1; Killer Cell Immunoglo

  • AA Sequence

    HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

  • Predicted Molecular Mass

    26.8 kDa

  • Molecular Weight

    Approximately 34 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • KIR2DS1 Protein, Human (P.pastoris, His) Product Image
    1/16
  • KIR2DS1 Protein, Human (P.pastoris, His) Product Image