1. Recombinant Proteins
  2. Receptor Proteins
  3. Killer-Cell Immunoglobulin-Like Receptors
  4. KIR2DS1
  5. KIR2DS1 Protein, Human (P.pastoris, His)

KIR2DS1 Protein, Human (P.pastoris, His)

Cat. No.: HY-P71823
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
5 μg $130 In-stock
Estimated Time of Arrival: December 31
10 μg $225 In-stock
Estimated Time of Arrival: December 31
50 μg $425 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

KIR2DS1 Protein, Human (P.pastoris, His) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

P.pastoris

Tag

N-His

Accession

Q14954 (22H-245H)

Gene ID
Synonyms
KIR2DS1; CD158 antigen-like family member H; MHC class I NK cell receptor Eb6 ActI
AA Sequence

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

Molecular Weight

Approximately 34 kDa

Purity

Greater than 90% as determined by SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against solution in Tris-based buffer, 50% glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -737°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR2DS1 Protein, Human (P.pastoris, His)
Cat. No.:
HY-P71823
Quantity:
MCE Japan Authorized Agent: