KLRG1 Protein, Cynomolgus (HEK293, His)

KLRG1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived KLRG1 protein, expressed by HEK293, with N-His tag.

KLRG1 Protein assumes a pivotal role in exerting inhibitory effects on both natural killer (NK) cells and T-cell functions through its binding to non-MHC ligands. By engaging in missing self-recognition, KLRG1 monitors the expression of classical cadherins, including E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4 on target cells. Existing as both a monomer and homodimer with disulfide linkage, KLRG1 employs its immunoreceptor tyrosine-based inhibitory motif (ITIM) to interact with signaling molecules such as PTPN11 and INPP5D, thereby modulating cellular responses and contributing to immune regulation.

Cynomolgus

HEK293

N-His

A0A2K5WAP9 (L60-P189)

102130067

Partial

LCQGSKYSTCASCPSCPDHWMKYGNHCYYFSVEKKDWISSLEFCLARDSHLLMITDKQEMSLLQDFLSEAFHWVGLRNNSGWRWEDGSPLNFSRIYSNSLVQTCGAINKNSLQASSCEVSLQWVCKKVSP

Approximately 18-21 kDa & 22-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution in PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.