KLRG1 Protein, Human (HEK293, His)
KLRG1 Protein exerts inhibitory effects on NK cells and T-cells by binding to their non-MHC ligands, potentially recognizing "missing self" through conserved sites on classical cadherins like E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4. Existing as a monomer and homodimer connected by disulfide bonds, KLRG1 interacts with PTPN11 and INPP5D via its ITIM motif, suggesting involvement in signal transduction pathways. KLRG1 Protein, Human (HEK293, His) is the recombinant human-derived KLRG1 protein, expressed by HEK293, with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
KLRG1 Protein exerts inhibitory effects on NK cells and T-cells by binding to their non-MHC ligands, potentially recognizing "missing self" through conserved sites on classical cadherins like E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4. Existing as a monomer and homodimer connected by disulfide bonds, KLRG1 interacts with PTPN11 and INPP5D via its ITIM motif, suggesting involvement in signal transduction pathways. KLRG1 Protein, Human (HEK293, His) is the recombinant human-derived KLRG1 protein, expressed by HEK293, with N-His labeled tag.
Background
The KLRG1 protein exhibits an inhibitory role on the functions of natural killer (NK) cells and T-cells by binding to their non-MHC ligands. It is potentially involved in the recognition of "missing self" by binding to a conserved site on classical cadherins, specifically monitoring the expression of E-cadherin/CDH1, N-cadherin/CDH2, and R-cadherin/CDH4 on target cells. KLRG1 forms a monomer and homodimer that are connected by disulfide bonds. Furthermore, it interacts with PTPN11 and INPP5D through its ITIM motif, potentially participating in signal transduction pathways.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
Q96E93 (L60-F195)
-
Gene ID10219
-
Molecular Construction
-
N-term
-
His
-
KLRG1 (L60-F195)
Accession # Q96E93 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KLRG1; Mast Cell Function-Associated Antigen; Killer Cell Lectin Like Receptor G1; ITIM-Containing Receptor MAFA-L; CLEC15A; MAFA-Like Receptor; MAFA; Mast Cell Function-Associated Antigen (ITIM-Containing); MAFA-L; C-Type Lectin Domain Family 15, Member
-
AA Sequence
LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKCPFADQALF
-
Predicted Molecular Mass
17.4 kDa
-
Molecular Weight
Approximately 30-42 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
