KMT2C Protein, Human
KMT2C Protein, Human is the recombinant human-derived KMT2C, expressed by E. coli , with tag Free labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
KMT2C Protein, Human is the recombinant human-derived KMT2C, expressed by E. coli , with tag Free labeled tag.
KMT2C is a histone methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the epsilon-amino group of Lys-4 on histone H3 (H3K4). As part of the chromatin remodeling machinery, it predominantly generates H3K4me1 methylation marks at active chromatin sites where transcription and DNA repair occur. Similar to KMT2D (by similar), KMT2C likely plays a redundant role in enriching the H3K4me1 mark on primed and active enhancer elements.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q8NEZ4-1 (V1055-N1144)
-
Gene ID58508
-
Protein Length
Partial
-
Synonyms
KMT2C; Homologous To ALR Protein; Prev. MLL3; Myeloid/Lymphoid Or Mixed-Lineage Leukemia 3; Histone-Lysine N-Methyltransferase 2C; [Histone H3]-Lysine(4) N-Methyltransferase; HALR; Histone-Lysine N-Methyltransferase MLL3; KIAA1506; Lysine N-Methyltransfer
-
AA Sequence
VWCRHCGATSAGLRCEWQNNYTQCAPCASLSSCPVCYRNYREEDLILQCRQCDRWMHAVCQNLNTEEEVENVADIGFDCSMCRPYMPASN
-
Predicted Molecular Mass
10.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
