Kremen-2 Protein, Cynomolgus (HEK293, His)
Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting LRP5 and LRP6 endocytosis. Its role in limb development ensures correct patterning and negatively affects bone formation. Kremen-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Kremen-2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Kremen-2 protein is a receptor for Dickkopf protein and cooperates with DKK1/2 to inhibit Wnt/β-catenin signaling by promoting LRP5 and LRP6 endocytosis. Its role in limb development ensures correct patterning and negatively affects bone formation. Kremen-2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Kremen-2 protein, expressed by HEK293 , with C-His labeled tag.
Background
Kremen-2, functioning as a receptor for Dickkopf proteins, operates in collaboration with DKK1/2 to restrain Wnt/beta-catenin signaling by facilitating the endocytosis of Wnt receptors LRP5 and LRP6. This regulatory role extends to limb development, where Kremen-2 acts to attenuate Wnt signaling, ensuring the normal patterning of limbs and exerting a negative influence on bone formation. Additionally, Kremen-2 forms a ternary complex with DKK1 and LRP6, emphasizing its involvement in intricate molecular interactions crucial for modulating key signaling pathways. The interaction with ERLEC1 further underscores the multifaceted regulatory functions of Kremen-2 in cellular processes.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag C-8*His
-
Accession
XP_005591068.2 (G26-A364)
-
Molecular Construction
-
N-term
-
Kremen-2 (G26-A364)
Accession # XP_005591068.2 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
KREMEN2; Kringle Domain-Containing Transmembrane Protein 2; Kringle Containing Transmembrane Protein 2; Dickkopf Receptor 2; KRM2; Kremen Protein 2; Kringle-Containing Protein Marking The Eye And The Nose; MGC10791
-
AA Sequence
GSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPPGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPAAPEGSAQTPAAPLDGANVSCSPRPGAPQAA
-
Predicted Molecular Mass
37 kDa
-
Molecular Weight
Approximately 50-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
