LAG-3 Protein, Canine (HEK293, Flag, His)
Based on 1 Customer Validation
LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Canine (HEK293, Flag, His) is the recombinant canine-derived LAG-3 protein, expressed by HEK293 , with C-His, C-Flag labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Canine (HEK293, Flag, His) is the recombinant canine-derived LAG-3 protein, expressed by HEK293 , with C-His, C-Flag labeled tag.
Background
LAG-3 (Lymphocyte activation gene 3) protein is an inhibitory receptor expressed on antigen-activated T-cells, delivering inhibitory signals upon binding to ligands such as FGL1. Serving as a major ligand of LAG3, FGL1 is responsible for LAG3's T-cell inhibitory function. Following T-cell receptor (TCR) engagement, LAG3 associates with CD3-TCR in the immunological synapse, directly inhibiting T-cell activation. LAG3 may synergistically inhibit antigen-specific T-cell activation with PDCD1/PD-1, possibly acting as a coreceptor for PD-1. It negatively regulates the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Constitutively expressed on a subset of regulatory T-cells (Tregs), LAG3 contributes to their suppressive function, mediating immune tolerance. Additionally, LAG3 acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation and binds to MHC class II (MHC-II), possibly functioning as a ligand for MHC-II on antigen-presenting cells, thereby promoting APC activation/maturation and driving Th1 immune responses.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-His;C-Flag
-
Accession
A0A8C0JP39 (P23-S441)
-
Gene ID/
-
Protein Length
Partial
-
Synonyms
LAG3; Lymphocyte-Activation Gene 3; Lymphocyte Activating 3; CD223 Antigen; CD223; LAG-3; Lymphocyte Activation Gene 3 Protein; FDC
-
AA Sequence
PGSGTEVQVVWAQEGAPVQLPCSPTIPLQDVSLLRNAGVTWYHLPESGPAAPALSLRPAAPSARGPGPRSYVVLMRAPGGLRSGRPPLQPRVQLEERGLQRGDFSLWLRPARRADAGEYRAAVHLRDRSLACRLRLRVGQASMTASPPGALRISDWVILNCSFSRPDLPASVHWFRGRVPVPESPHYHLAGSFLFLPQISPSDSGPWGCTLTYRDGFNVSIMYNLTVLGLEPSGPLTVYTGAGSRVGLPCRLPPGVGTQSFLTAKWTPPGGGPDLLVAGDDGNFTLQLEVVNQAQAGTYTCHIHLQGQQLSTTVTLAVITVTPKSSGLPGNLRKLLCEVTPASGQERFVWSPLDKQSWRGSPGPCLEMQETRLLSQPWQCHVYQAERLLGTAVYLIDPAGPGAQRSGRAQGVLKTGHLS
-
Molecular Weight
Approximately 47 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)