LAIR1 Protein, Mouse (HEK293, mFc)

The LAIR1 protein functions as an inhibitory receptor that negatively regulates NK cells, B cells, and T cells. LAIR1 is activated by tyrosine phosphorylation, recruits PTPN6 and PTPN11, and exerts downstream inhibitory effects. LAIR1 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived LAIR1 protein, expressed by HEK293, with C-mFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LAIR1 protein functions as an inhibitory receptor that negatively regulates NK cells, B cells, and T cells. LAIR1 is activated by tyrosine phosphorylation, recruits PTPN6 and PTPN11, and exerts downstream inhibitory effects. LAIR1 Protein, Mouse (HEK293, mFc) is the recombinant mouse-derived LAIR1 protein, expressed by HEK293, with C-mFc labeled tag.

Background

The LAIR1 protein operates as an inhibitory receptor, constitutively exerting a negative regulatory influence on the cytolytic function of natural killer (NK) cells, B-cells, and T-cells. Upon activation through tyrosine phosphorylation, LAIR1 recruits and activates phosphatases PTPN6 and PTPN11, leading to downstream inhibitory effects. Notably, it diminishes the increase in intracellular calcium triggered by B-cell receptor ligation. Beyond its role with SH2-containing phosphatases, LAIR1 independently modulates cytokine production in CD4+ T-cells, down-regulating IL2 and IFNG while inducing the secretion of transforming growth factor beta. It further regulates IgG and IgE production in B-cells, as well as the secretion of IL8, IL10, and TNF. LAIR1's impact extends to inhibiting proliferation, inducing apoptosis in myeloid leukemia cell lines, preventing nuclear translocation of NF-kappa-B p65 subunit/RELA, and inhibiting the phosphorylation of I-kappa-B alpha/CHUK in these cells. Moreover, it hinders the differentiation of peripheral blood precursors into dendritic cells. Interaction-wise, LAIR1 associates with the SH2 domains of tyrosine-protein phosphatases PTPN6 and PTPN11 constitutively and binds with high affinity to extracellular matrix collagens, a functionally significant interaction.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-mFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LAIR1 (Q22-Y141)
      Accession # Q8BG84-1
    • mFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    LAIR1; Leukocyte-Associated Ig-Like Receptor 1; Leukocyte Associated Immunoglobulin Like Receptor 1; Immunoglobulin Heavy Chain Variable Region; LAIR-1; CD305 Antigen; CD305; HLAIR1; Leukocyte-Associated Immunoglobulin-Like Receptor 1

  • AA Sequence

    QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTY

  • Predicted Molecular Mass

    40.6 kDa

  • Molecular Weight

    Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    Monomer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00