1. Recombinant Proteins
  2. CD Antigens
  3. LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His)

LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P77436
Handling Instructions Technical Support

The LAMP3/CD208 protein is a lysosomal membrane glycoprotein that actively participates in the unfolded protein response (UPR), aiding protein degradation and cell survival during proteasome dysfunction. It is essential for lysosome-autophagosome fusion, where it regulates the autophagy process. LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LAMP3/CD208 protein is a lysosomal membrane glycoprotein that actively participates in the unfolded protein response (UPR), aiding protein degradation and cell survival during proteasome dysfunction. It is essential for lysosome-autophagosome fusion, where it regulates the autophagy process. LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived LAMP3/CD208 protein, expressed by HEK293 , with C-His labeled tag.

Background

LAMP3/CD208 protein, a lysosomal membrane glycoprotein, actively participates in the unfolded protein response (UPR), contributing to protein degradation and cell survival under conditions of proteasomal dysfunction. Additionally, it plays a crucial role in facilitating the fusion of lysosomes with autophagosomes, thereby modulating the autophagic process. Beyond its role in cellular homeostasis, LAMP3/CD208 functions in promoting hepatocellular lipogenesis by activating the PI3K/Akt pathway. Moreover, there is evidence suggesting its involvement in dendritic cell function and adaptive immunity. Structurally, LAMP3/CD208 acts as a monomer and interacts with FURIN to carry out its diverse cellular functions.

Biological Activity

Measured by its ability to enhance MDA-MB-231 cells migration. The ED50 for this effect is 0.397 μg/mL, corresponding to a specific activity is 2.516×103 U/mg.

  • Measured by its ability to enhance MDA-MB-231 cells migration. The ED50 for this effect is 0.397 μg/mL, corresponding to a specific activity is 2.516×103 U/mg.
Species

Rhesus Macaque

Source

HEK293

Tag

C-6*His

Accession

Q8MJJ2 (K28-T381)

Gene ID
Molecular Construction
N-term
LAMP3 (K28-T381)
Accession # Q8MJJ2
His
C-term
Protein Length

Lumenal Domain

Synonyms
Lysosome-associated membrane glycoprotein 3; LAMP-3; DCLAMP; TSC403
AA Sequence

KAFPKTRDYSQPTAAATGQDIAKPVQQPANQAPHQTLAARLMDGHITFQTAATIKTPTTTPVTTKNTPTTSPIIYTLVTTQATSNNSHTAPPLTKVTVGPSLAPYSLPPTITPPAHTTGTSSSTVNHTTGNATQPSNQTTLPATLSIAPHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGSTLAPQPSSIKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNLDPNATQASGNCGTRNSNLLLNFQGGFVNLTFTKDEGSYYISEVGACLTVSDPETIYQGMKHAVVMFQTVVGHSFKCVSEQSLQLSAHLQLKTTNVQLQAFDFEDDHFGNVDECSSDYT

Molecular Weight

Approximately 60-95 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, PH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAMP3/CD208 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P77436
Quantity:
MCE Japan Authorized Agent: