LAMP5 Protein, Mouse (HEK293, Fc)
LAMP5 Protein significantly contributes to short-term synaptic plasticity in a specific subset of GABAergic neurons in the brain. LAMP5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LAMP5 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LAMP5 Protein significantly contributes to short-term synaptic plasticity in a specific subset of GABAergic neurons in the brain. LAMP5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived LAMP5 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The LAMP5 protein plays a significant role in short-term synaptic plasticity within a specific subset of GABAergic neurons in the brain.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9D387 (E30-E235)
-
Molecular Construction
-
N-term
-
LAMP5 (E30-E235)
Accession # Q9D387 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
LAMP5; DJ1119D9.3; Prev. C20orf103; Lysosomal-Associated Membrane Protein Family, Member 5; BAD-LAMP; Brain And Dendritic Cell Associated LAMP; Lysosomal Associated Membrane Protein Family Member 5; Lysosome-Associated Membrane Protein 5; UNC-46; Chromoso
-
AA Sequence
EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQAEISLTRGAEVKGHCGHNESELEVFWVDHAYTLRMLFVKESHNTSKGPEATWNLNKVHFVYDSSEKTHFKAPVKVNKYIASSHHLSALVTPAGMSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEQEQLEE
-
Predicted Molecular Mass
50 kDa
-
Molecular Weight
Approximately 60-70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
