Layilin/LAYN Protein, Rat (HEK293)
Based on 1 Customer Validation
Layilin (LAYN), predicted to bind hyaluronic acid, is expected to function as a membrane integral component. Its biased expression in tissues like the spleen (RPKM 32.4) and lung (RPKM 17.5) underscores Layilin's potential roles in diverse cellular processes across various physiological contexts. Layilin/LAYN Protein, Rat (HEK293) is the recombinant rat-derived Layilin/LAYN protein, expressed by HEK293 , with tag free.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Layilin (LAYN), predicted to bind hyaluronic acid, is expected to function as a membrane integral component. Its biased expression in tissues like the spleen (RPKM 32.4) and lung (RPKM 17.5) underscores Layilin's potential roles in diverse cellular processes across various physiological contexts. Layilin/LAYN Protein, Rat (HEK293) is the recombinant rat-derived Layilin/LAYN protein, expressed by HEK293 , with tag free.
Background
Layilin (LAYN) is predicted to possess hyaluronic acid binding activity and is anticipated to serve as an integral component of the cellular membrane. This protein, orthologous to human LAYN (layilin), exhibits biased expression in various tissues, including the spleen (RPKM 32.4) and lung (RPKM 17.5), highlighting its potential involvement in diverse cellular processes and physiological contexts.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Layilin at 5 µg/mL (100 µL/well) can bind biotinylated hyaluronan. The ED50 for this effect is 7.316 µg/mL.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag Tag Free
-
Accession
NP_001178926.1 (H25-E224)
-
Molecular Construction
-
N-term
-
LAYN (H25-E224)
Accession # NP_001178926.1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
LAYN; FLJ30977; Layilin; FLJ31092
-
AA Sequence
HLLSGDLDPRGGQRFCWEGTRRPCYRVIYFHDTSQRRNFEEAKEACMKDGGQLASIETADEQRLIENFIESLQASDGDFWIGLKRLEEKQHNSTACQDLYAWTDGSLSQFRNWYMDEPSCESEVCVVMYHQPSAPPGIGGPYMFQWNDDRCNTKKNFICKYSDDKPSTTPSLSPGGEATEPAAPILPEETLEIDTKERRE
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
