LCC Protein, Unknown prokaryotic organism
LCC proteolyzes cutin, the structural polyester of plant cuticles. LCC Protein, Unknown prokaryotic organism is the recombinant LCC protein, expressed by E. coli , with tag free.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LCC proteolyzes cutin, the structural polyester of plant cuticles. LCC Protein, Unknown prokaryotic organism is the recombinant LCC protein, expressed by E. coli , with tag free.
Background
The LCC protein plays a pivotal role in cellular processes as it catalyzes the hydrolysis of cutin, a polyester crucial for the structural composition of the plant cuticle. As evidenced by various studies, LCC exhibits esterase activity toward p-nitrophenol-linked aliphatic esters (pNP-aliphatic esters), demonstrating a preference for short-chain substrates (up to C4). Interestingly, LCC shows incapacity to hydrolyze olive oil. Moreover, this versatile enzyme demonstrates the ability to degrade poly(ethylene terephthalate), the most prevalent polyester plastic globally, and can also depolymerize poly(epsilon-caprolactone) (PCL), a synthetic aliphatic biodegradable polyester. The multifaceted substrate specificity of LCC underscores its significance in the enzymatic breakdown of diverse polyesters, highlighting its potential applications in both natural and synthetic polymer degradation processes.
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
G9BY57 (S36-Q293)
-
Gene ID/
-
Molecular Construction
-
N-term
-
LCC (S36-Q293)
Accession # G9BY57 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Leaf-branch compost cutinase; EC:3.1.1.74; LC-cutinase; LCC; PET-digesting enzyme; Poly(ethylene terephthalate) hydrolase; PET hydrolase; PETase; EC:3.1.1.101; EC:3.1.1.101
-
AA Sequence
SNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNASHFAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRTNNRHCQ
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
