LCC Protein, Unknown prokaryotic organism

LCC proteolyzes cutin, the structural polyester of plant cuticles. LCC Protein, Unknown prokaryotic organism is the recombinant LCC protein, expressed by E. coli , with tag free.

The LCC protein plays a pivotal role in cellular processes as it catalyzes the hydrolysis of cutin, a polyester crucial for the structural composition of the plant cuticle. As evidenced by various studies, LCC exhibits esterase activity toward p-nitrophenol-linked aliphatic esters (pNP-aliphatic esters), demonstrating a preference for short-chain substrates (up to C4). Interestingly, LCC shows incapacity to hydrolyze olive oil. Moreover, this versatile enzyme demonstrates the ability to degrade poly(ethylene terephthalate), the most prevalent polyester plastic globally, and can also depolymerize poly(epsilon-caprolactone) (PCL), a synthetic aliphatic biodegradable polyester. The multifaceted substrate specificity of LCC underscores its significance in the enzymatic breakdown of diverse polyesters, highlighting its potential applications in both natural and synthetic polymer degradation processes.

Others

E. coli

Tag Free

G9BY57 (S36-Q293)

/

Full Length of Mature Protein

SNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNASHFAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRTNNRHCQ

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.