LDLR Protein, Mouse (Biotinylated, A23V, C27G, HEK293, His)
LDLR Protein crucially binds to LDL, transporting cholesterol through endocytosis. Clustering into clathrin-coated pits initiates internalization. Interactions with DAB2, LDLRAP1, ARRB1, SNX17, and immature PCSK9 contribute to its functional versatility. The NPXY motif interaction is impaired by tyrosine phosphorylation. LDLR Protein, Mouse (Biotinylated, A23V, C27G, HEK293, His) is the recombinant mouse-derived LDLR protein, expressed by HEK293 , with C-His labeled tag and A23V, C27G mutation.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
LDLR Protein crucially binds to LDL, transporting cholesterol through endocytosis. Clustering into clathrin-coated pits initiates internalization. Interactions with DAB2, LDLRAP1, ARRB1, SNX17, and immature PCSK9 contribute to its functional versatility. The NPXY motif interaction is impaired by tyrosine phosphorylation. LDLR Protein, Mouse (Biotinylated, A23V, C27G, HEK293, His) is the recombinant mouse-derived LDLR protein, expressed by HEK293 , with C-His labeled tag and A23V, C27G mutation.
Background
The LDLR protein plays a crucial role in binding to LDL, the primary lipoprotein responsible for transporting cholesterol in the bloodstream, and facilitating its internalization into cells through endocytosis. To undergo internalization, receptor-ligand complexes must first cluster into clathrin-coated pits. Additionally, LDLR interacts with various proteins, including DAB2 and LDLRAP1 through its NPXY motif, with the interaction impaired by tyrosine phosphorylation of the NPXY motif. It also interacts with ARRB1 and SNX17, further contributing to its functional versatility. Furthermore, LDLR interacts with the immature form of PCSK9, aiding in the regulation of LDL cholesterol levels.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P35951/NP_034830.2 (A22-R790, A23V, C27G)
-
Molecular Construction
-
N-term
-
LDLR (A22-R790, A23V, C27G)
Accession # P35951/NP_034830.2 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
LDLR; LDL Receptor; Low Density Lipoprotein Receptor; Low-Density Lipoprotein Receptor Class A Domain-Containing Protein 3; Low-Density Lipoprotein Receptor; Familial Hypercholesterolemia; LDLCQ2; Low Density Lipoprotein
-
AA Sequence
AVEDSGSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCMSVTCQSNQFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGCPPKTCSQDDFRCQDGKCISPQFVCDGDRDCLDGSDEAHCQATTCGPAHFRCNSSICIPSLWACDGDVDCVDGSDEWPQNCQGRDTASKGVSSPCSSLEFHCGSSECIHRSWVCDGEADCKDKSDEEHCAVATCRPDEFQCADGSCIHGSRQCDREHDCKDMSDELGCVNVTQCDGPNKFKCHSGECISLDKVCDSARDCQDWSDEPIKECKTNECLDNNGGCSHICKDLKIGSECLCPSGFRLVDLHRCEDIDECQEPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVGSIGYLLFTNRHEVRKMTLDRSEYTSLLPNLKNVVALDTEVTNNRIYWSDLSQKKIYSALMDQAPNLSYDTIISEDLHAPDGLAVDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAGSRPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIHSLVTENIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTILEDENRLAHPFSLAIYEDKVYWTDVINEAIFSANRLTGSDVNLVAENLLSPEDIVLFHKVTQPRGVNWCETTALLPNGGCQYLCLPAPQIGPHSPKFTCACPDGMLLAKDMRSCLTEVDTVLTTQGTSAVRPVVTASATRPPKHSEDLSAPSTPRQPVDTPGLSTVASVTVSHQVQGDMAGRGNEEQPHGMR
-
Predicted Molecular Mass
85.7 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
