LIMK1 Protein, Human (D460N, sf9, His)

The LIMK1 protein is an important serine/threonine protein kinase that controls actin dynamics downstream of Rho GTPases. Activation of ROCK1, PAK1, and PAK4 phosphorylates LIMK1, allowing it to phosphorylate and inhibit actin depolymerizing factors, including cofilin-1/CFL1 and destrin/DSTN. LIMK1 Protein, Human (D460N, sf9, His) is the recombinant human-derived LIMK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

LIMK1 Protein, a serine/threonine-protein kinase, plays a vital role in regulating actin filament dynamics, acting downstream of various Rho family GTPase signal transduction pathways. Activation of LIMK1 is mediated by upstream kinases, including ROCK1, PAK1, and PAK4, which phosphorylate a threonine residue in its activation loop. Subsequently, LIMK1 phosphorylates and inactivates actin-binding/depolymerizing factors such as cofilin-1/CFL1, cofilin-2/CFL2, and destrin/DSTN, preventing the cleavage of filamentous actin (F-actin) and stabilizing the actin cytoskeleton. This regulation influences diverse actin-dependent processes, including cell motility, cell cycle progression, and differentiation. Additionally, LIMK1 phosphorylates TPPP on serine residues, promoting microtubule disassembly and stimulating axonal outgrowth, potentially contributing to brain development. Notably, LIMK1 has a dominant negative effect on actin cytoskeletal changes and is crucial for the atypical chemokine receptor ACKR2-induced phosphorylation of cofilin (CFL1).

Human

Sf9 insect cells

N-8*His

P53667 (R329-G638, D460N)

3984

Partial

RPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRNLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESG

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.